KEGG   Prevotella ruminicola: PRU_1860Help
Entry
PRU_1860          CDS       T01212                                 

Gene name
tpiA
Definition
(RefSeq) triose-phosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pru  Prevotella ruminicola
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pru00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PRU_1860 (tpiA)
   01230 Biosynthesis of amino acids
    PRU_1860 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PRU_1860 (tpiA)
   00051 Fructose and mannose metabolism
    PRU_1860 (tpiA)
   00562 Inositol phosphate metabolism
    PRU_1860 (tpiA)
Enzymes [BR:pru01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PRU_1860 (tpiA)
Exosome [BR:pru04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PRU_1860 (tpiA)
  Exosomal proteins of bladder cancer cells
   PRU_1860 (tpiA)
  Exosomal proteins of melanoma cells
   PRU_1860 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2239446..2240207
Genome map
AA seq 253 aa AA seqDB search
MRKKIVAGNWKMNMNLQDGIALAKELNETLKADKPNCGVVICTPFIHLASIAQFLDQDII
GLGAENCADKEKGAFTGEVSAEMVKSTGAQYVILGHSERREYYKETPEILKEKVLLAQKN
DLKVIFCIGESLEEREAGKQNEVVKAELEGSVFNLSEEDFRKIVIAYEPIWAIGTGKTAT
AEQAEEIHAYIRSIIAEKYGQAVADDTTILYGGSCKASNAPELFAKPDIDGGLIGGASLK
AADFKGIIDAWKK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagaaagaaaattgtagcaggaaactggaagatgaacatgaatctccaggatggtatc
gctcttgcaaaggagctgaacgagactctgaaggctgacaagccaaactgtggtgtagta
atctgcactccattcatccacctcgcatctatcgcacagttcctcgaccaggacatcatc
ggcctgggtgctgagaactgcgctgacaaggagaagggtgccttcactggtgaggttagt
gccgagatggtaaagagcacaggtgctcagtacgttattctgggtcactcagagcgtcgt
gagtactacaaggagactccagagatcctgaaggagaaggtgcttctggctcagaagaac
gatctgaaggttatcttctgtatcggtgagagcctggaggagcgcgaggctggcaagcag
aacgaggtagtaaaggccgagctcgagggttcagtattcaacctctctgaggaggacttc
cgtaagatcgttatcgcctacgagccaatctgggctatcggtaccggtaagaccgctact
gctgagcaggctgaggagatccacgcttacatccgttcaatcatcgccgagaagtatggt
caggctgtagctgacgacactactatcctttacggtggtagctgcaaggctagcaacgct
cctgagctgtttgctaagcccgacatcgatggtggtctgattggtggtgcttcattgaag
gctgccgacttcaagggtattatcgacgcttggaagaagtaa

DBGET integrated database retrieval system