KEGG   Prevotella ruminicola: PRU_1883Help
Entry
PRU_1883          CDS       T01212                                 

Definition
lysozyme (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
pru  Prevotella ruminicola
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2266715..2267179
Genome map
AA seq 154 aa AA seqDB search
MQITDTLLQKLMEMEGCRLSAYRDEGGVPTIGYGHTRGVRMGDRISPQQARDWLLQDATE
VMRQVRRLHVARTEAQLEALTSFAFNVGIGRLKQSTLLKTIRQGGSKAAIQRQFKRWVYA
GGSKLPGLVARRQWEAEHFFAPSYPTDDEIIDRV
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgcagattacagacacacttttacagaaattgatggagatggagggatgccgactaagc
gcttatcgcgacgagggcggcgtgcctaccatcggctacggacacacacgcggtgtgcgc
atgggcgaccgcatcagcccccagcaggctcgcgactggctgctacaggatgccaccgag
gtgatgcgacaggtgcgacgcctgcacgtggcacgcaccgaggcgcaactagaggcactc
acatcgtttgcctttaacgtgggcatcggacggctgaagcagtcaaccctgctcaaaacc
atccgccaaggcggcagcaaggctgccatccagcgccagtttaaacgatgggtgtatgcc
ggcggtagcaagttgcccggtttggtagcccgtcgccaatgggaggccgaacacttcttc
gcccccagctacccaacggatgacgaaatcatcgaccgggtgtga

DBGET integrated database retrieval system