KEGG   Prevotella ruminicola: PRU_2205Help
Entry
PRU_2205          CDS       T01212                                 

Definition
AMP-binding enzyme
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pru  Prevotella ruminicola
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:pru01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pru00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:pru00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:pru00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:pru00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2645215..2646867
Genome map
AA seq 550 aa AA seqDB search
MVERFLKQTHFESVEDYNKNLEFIIPENFNFAYDVMDAWAEEAPEKLALLWTNDQGEEIR
TTYGELKEQSDQAASYLMSLGIGKGDPVMLILKRHYEWWVIMLALCKIGAIVIPATHMLT
KHDYVYRNTRASVKAIICADDDYIISQIKLAMPESPTVKQYITLRDEEGFHNWKAEWQQA
PKFERPAFVNNNEDTMIMYFTSGTSGEPKMVAHDYLYAMGHLTTGVFWHNLHEGSLHLTV
ADTGWGKAVWGKFYGQWFAGATVFVFDHEKFNADTLLRQMEKYKVTSFCAPPTIYRFMIR
EDLSKYDLSSLQYCCTAGEALNPAVYDKFYEKTGIRMMEGFGQTETTMTLGTFPWMTPKP
GSMGIPNAQYNIDLLRADGTSCEDGEKGEIVVRVGDKKPIGLFKGYYRDEEKTREAWHDG
IYHTGDMAWRDEDGYYWFEGRIDDVIKSSGYRIGPFEVESALMTHPAVVECAITGVPDDI
RGMVVKATVVLGKEWKDKAGDDLVKELQQHVKKETAPYKYPRIVEFVDELPKTISGKIRR
VEIRKKDAEK
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atggtagaaagatttttaaagcagacacatttcgagtctgtagaggattacaataagaat
ctggagtttatcattccagagaacttcaactttgcctacgacgtgatggatgcgtgggca
gaggaagcacccgagaagttagcattgctttggaccaacgaccagggcgaagagatacgt
accacctatggtgagttaaaggaacagagcgatcaggctgcatcatacctgatgtcgctg
ggtatcggtaagggcgatcccgtcatgctcatcctgaagcgtcactacgagtggtgggtt
atcatgttggcgttatgtaagatcggtgccattgtaattcccgctacccacatgctcacc
aagcacgactacgtatatcgtaacacacgtgcctcagtaaaggccatcatctgtgctgac
gatgactatatcatcagtcagatcaagctggccatgcctgagagtcctacggtaaagcaa
tatatcacactgcgcgacgaggaaggtttccacaactggaaggcagaatggcagcaggcc
cccaagttcgagcgtcctgccttcgttaataacaacgaagacaccatgattatgtacttc
acctctggtaccagtggcgagccaaagatggttgcacacgattatctgtatgccatgggc
cacctcaccacaggtgtattctggcacaacctgcacgaaggctcactccacctcaccgta
gccgatactggttggggtaaggctgtatggggtaagttctacggtcagtggtttgccggt
gctaccgtgttcgtattcgaccacgagaagtttaatgccgacaccctgctgcgccagatg
gagaagtataaggttaccagtttctgtgcacctcccaccatctaccgttttatgattcgt
gaggatttgagcaagtatgacctgagcagtctccagtattgctgtaccgcaggcgaggcc
ctgaaccccgcagtatatgataagttctacgagaagaccggcatccgcatgatggagggc
ttcggtcagaccgaaaccaccatgaccctcggtaccttcccttggatgacaccaaagccc
ggttcgatgggtatccctaatgctcagtacaatattgatctgctgcgtgccgacggaact
tcatgtgaggatggtgagaaaggtgagatcgtggtacgcgtaggcgataagaagcctatc
ggtttgtttaagggctactaccgcgatgaggagaaaacccgcgaggcctggcacgacggc
atctatcacaccggagatatggcttggcgcgatgaagacggttactactggttcgaaggt
cgtatcgacgatgtgatcaagagctcaggttaccgcattggcccattcgaggttgagagt
gccctgatgactcaccctgccgtagttgagtgcgccatcacaggtgtacccgacgatatc
cgcggtatggtggtaaaggcaaccgttgtactcggcaaagagtggaaggacaaggctggc
gacgatctcgtaaaggaactgcagcagcatgttaaaaaggagacagcgccttacaagtac
ccacgtattgtggagtttgttgacgaactgccaaagaccatcagtggtaagattcgccgc
gtagagattcgcaagaaagacgcggagaaataa

DBGET integrated database retrieval system