KEGG   Prevotella ruminicola: PRU_2328Help
Entry
PRU_2328          CDS       T01212                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
pru  Prevotella ruminicola
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:pru00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:pru00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2809809..2811260
Genome map
AA seq 483 aa AA seqDB search
MKLNELLKNVEVLNTQGDVDVEITGVNIDSRRIEAGHLFVAIPGTVTDGHKFIPKAIELG
ATAVLCEKLPEEQDPKVTFVQVASTESCVGEVATQFYGDPSRKLKLVGVTGTNGKTTIAT
LLYNMFRKFGHKCGLLSTVCNYIEDEAIPADHTTPDPIELNRLLAQMVDAGCEYAFMECS
SHAIAQKRIGGLKFAGGLFTNLTRDHLDYHKTFENYRDAKKAFFDGLEKDAFAITNADDK
NGMVMVQNCKANVKTYSTRTMADFKAKIIECHFEGMYLDINGKEVGVQFIGKFNVSNLLA
VYGAAVMLGKKPEDILLIMSTLKSVNGRLEPIHSPEGYTAIVDYAHTPDALENVLNAIHE
VLNGKGKVITVCGAGGNRDKGKRPIMAQEAVKQSDKVIITSDNPRFEEPQDIINDMLAGL
DQKQMKKVVSIVDRREAIRTACMLAEKGDVILIAGKGHEDYQEIKGVKHHFDDKEVVKEI
FNS
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgaagttaaatgaactgctcaagaatgtagaagtactcaacacgcagggcgatgttgat
gtagagattaccggtgtgaacatcgattcacgtcgcattgaagctggtcatctgttcgtc
gccatcccaggcaccgtaaccgatggacacaagttcattccaaaagccattgagttagga
gcaactgctgtattgtgtgagaaattgccagaggagcaggatcctaaagtaacatttgtt
caagtagcatctaccgagagctgtgtaggcgaggttgccacccagttctatggcgaccca
tcgcgtaaactcaaactggtaggtgtaacaggtaccaatggtaagaccaccatcgccacc
ttattatataatatgttccgcaagttcggacataagtgcggtctgctgtcaactgtatgc
aactacatcgaggacgaggctatcccagccgatcatactactcccgaccccatcgagctg
aaccgcttgctggctcagatggttgatgccggttgtgagtatgccttcatggagtgctcg
agtcacgccatcgctcaaaagcgtatcggcggactgaagtttgcaggtggtttgttcacc
aacctgacacgcgaccacttggactatcacaagacctttgagaactaccgtgatgccaag
aaggctttcttcgatggtttggagaaagatgcctttgccattaccaatgccgacgacaag
aatggcatggtgatggtgcagaactgcaaggccaacgtaaagacctactctacccgcacc
atggccgatttcaaggctaagatcatcgagtgccacttcgagggtatgtatctcgacatc
aacggcaaggaggttggtgtgcagtttatcggtaagttcaacgtcagcaacctgctggcc
gtttatggcgctgctgtaatgctaggcaagaaacccgaggatatcctgctcattatgagt
acgttgaagagtgtgaacggaagattggagcctatccactcacccgaaggctatacagcc
attgttgactatgcccacacccctgatgccttggagaatgtgctcaatgccatccacgag
gtactgaacggtaagggtaaggtcatcaccgtatgcggtgctggcggtaatcgtgataaa
ggtaagcgccccatcatggcacaggaggccgttaagcagagcgataaggtgattatcacc
tctgataacccacgctttgaggagccacaggatatcatcaacgatatgctggcaggcctc
gaccagaagcagatgaagaaggttgtgagcattgttgatcgccgtgaggctatccgcacc
gcctgcatgctggccgaaaagggcgacgttattctgattgccggcaagggccatgaagac
tatcaggaaattaaaggtgtaaagcaccacttcgacgataaggaagtagtaaaggaaatt
tttaactcttaa

DBGET integrated database retrieval system