KEGG   Prevotella ruminicola: PRU_2332Help
Entry
PRU_2332          CDS       T01212                                 

Gene name
murG
Definition
undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase (EC:2.4.1.227)
Orthology
K02563  
UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [EC:2.4.1.227]
Organism
pru  Prevotella ruminicola
Pathway
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pru00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PRU_2332 (murG)
Enzymes [BR:pru01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.227  undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase
     PRU_2332 (murG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2815168..2816271
Genome map
AA seq 367 aa AA seqDB search
MEELRVIISGGGTGGHIFPAVSIANAVKALRPDAKILFVGALGRMEMQRVPAAGYEIKGL
PICGFDRKNLLKNFKVLYKIWKSQRMAKQIIKDFKPQVAVGVGGYASGPTLNKAAAMGIP
CLIQEQNSYAGVTNKLLAKKAAKICVAYEGMERFFPADKIILTGNPVRQALLDTKISRED
AIKTFGLDPAKKTILLVGGSLGARTVNESVLQHLDLVKAADAQFIWQTGKYYSAEIAKRL
KGQNIPNLVVTDFITDMGAAYKAADLVISRAGASSISEFCLIGKPVILVPSPNVAEDHQT
KNALALANRDAAIYVKDADAPATLLELAIKTVADAQKLQSLSENVLKLALPDSADIIAKE
VIKLAGK
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggaagaactgagagtcatcattagcggaggaggcactggaggacatattttcccagcc
gtctcgatagcaaatgccgtgaaggcactgcgccccgacgccaaaattctgtttgttggc
gcccttggacgaatggagatgcaacgcgtgccagctgcaggttacgaaatcaaaggtttg
cctatctgcggtttcgacagaaagaatttactcaagaactttaaggttctgtacaagata
tggaagagccagcgtatggccaagcagattatcaaggattttaagcctcaggtagctgta
ggtgttggcggttatgccagcggtcctacccttaacaaggcagccgccatgggtatcccc
tgcttgattcaggagcagaactcatacgcaggtgttaccaacaaactgttggcaaagaaa
gccgccaagatttgtgtggcttacgagggaatggagcgattcttccctgccgacaagatt
atccttacaggaaatcccgtacgtcaggctctgctcgacacaaagatttcgcgcgaggat
gccatcaagacctttggtctcgatcctgctaagaaaaccattctgctggtaggtggtagc
cttggcgcccgcaccgtcaacgagagcgtgctgcagcacctcgacctggtaaaggctgcc
gatgcccagtttatctggcaaaccggtaagtactacagcgccgagattgctaagcgtttg
aagggacagaatatccccaacctggtggtaaccgactttatcactgatatgggcgctgcc
tacaaggccgccgacctggttatcagtcgtgccggcgccagcagtatctctgagttctgt
cttattggcaagcccgttatcctggtaccaagtcctaatgtggcagaggatcaccagacc
aagaacgctctggctctggccaaccgcgatgccgccatctacgtgaaggatgccgatgca
ccagccaccctgttggagctggccatcaagacggttgccgatgcccagaagctgcagtcg
ctgagcgagaatgttctgaagctcgccctgcccgactctgccgacatcattgccaaggag
gttatcaagttggcaggaaagtaa

DBGET integrated database retrieval system