KEGG   Prevotella ruminicola: PRU_2547Help
Entry
PRU_2547          CDS       T01212                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
pru  Prevotella ruminicola
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:pru00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3082445..3083023)
Genome map
AA seq 192 aa AA seqDB search
MAKGKLIIISAPSGTGKSTIISWLMREHKELNLAYSISCTSRAPRGTEQNGVDYFFLTPE
EFRQRIENDEFLEYEEVYTDRFYGTLKSQVENQLEAGQNVVFDVDVKGGVNIKKFYGDKA
LSLFIQPPSINELRKRLEGRATDAPEVIDQRIARAEFELSFADKFDKVVINDKLEYAEAD
ALEIIKDFLDIE
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaggtaaattaattattatatcggctccatcgggcacaggcaagagtaccatt
atctcatggctgatgagagagcacaaggaactgaatctggcctactctatctcgtgcaca
tcgcgagctcctcgcggcacagagcagaacggggtagactatttcttcctgacaccagag
gaattccgccagcgtattgagaacgacgaattcctggagtacgaggaggtatataccgac
cgcttttacggcacgctgaagtcgcaggttgagaaccagttggaagctggacagaacgtg
gtgttcgacgttgacgtgaaaggtggcgtaaacatcaagaaattctatggcgacaaggcg
ctgagcctgtttatccagcccccatcaatcaacgaacttcgcaaacgattggaaggtcgt
gcaacagatgcccccgaggttatcgaccagcgtattgcccgtgccgagttcgaactctcg
tttgccgataagttcgataaggtggttatcaacgacaagttggaatatgccgaggctgat
gctttggaaataatcaaggattttttagatatcgaatga

DBGET integrated database retrieval system