KEGG   Prevotella ruminicola: PRU_2547Help
Entry
PRU_2547          CDS       T01212                                 

Definition
(GenBank) putative guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
pru  Prevotella ruminicola
Pathway
pru00230  Purine metabolism
pru01100  Metabolic pathways
Module
pru_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:pru00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    PRU_2547
Enzymes [BR:pru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     PRU_2547
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_22 AAA_18 AAA_33 AAA_16 ABC_tran AAA_25 NTPase_1 AAA_19 Rad17 RsgA_GTPase AAA_30
Motif
Other DBs
NCBI-ProteinID: ADE82886
UniProt: D5EX53
Position
complement(3082445..3083023)
Genome map
AA seq 192 aa AA seqDB search
MAKGKLIIISAPSGTGKSTIISWLMREHKELNLAYSISCTSRAPRGTEQNGVDYFFLTPE
EFRQRIENDEFLEYEEVYTDRFYGTLKSQVENQLEAGQNVVFDVDVKGGVNIKKFYGDKA
LSLFIQPPSINELRKRLEGRATDAPEVIDQRIARAEFELSFADKFDKVVINDKLEYAEAD
ALEIIKDFLDIE
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaggtaaattaattattatatcggctccatcgggcacaggcaagagtaccatt
atctcatggctgatgagagagcacaaggaactgaatctggcctactctatctcgtgcaca
tcgcgagctcctcgcggcacagagcagaacggggtagactatttcttcctgacaccagag
gaattccgccagcgtattgagaacgacgaattcctggagtacgaggaggtatataccgac
cgcttttacggcacgctgaagtcgcaggttgagaaccagttggaagctggacagaacgtg
gtgttcgacgttgacgtgaaaggtggcgtaaacatcaagaaattctatggcgacaaggcg
ctgagcctgtttatccagcccccatcaatcaacgaacttcgcaaacgattggaaggtcgt
gcaacagatgcccccgaggttatcgaccagcgtattgcccgtgccgagttcgaactctcg
tttgccgataagttcgataaggtggttatcaacgacaagttggaatatgccgaggctgat
gctttggaaataatcaaggattttttagatatcgaatga

DBGET integrated database retrieval system