KEGG   Prevotella ruminicola: PRU_2553Help
Entry
PRU_2553          CDS       T01212                                 

Definition
hypothetical protein
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
pru  Prevotella ruminicola
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pru00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PRU_2553
Enzymes [BR:pru01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     PRU_2553
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3089857..3090639
Genome map
AA seq 260 aa AA seqDB search
MVKRILFTAPDTYHVSLHEAFGKRPTCSFHPMFVPFISSTLLPPGGTFLPFCNQLASYDY
IICTSIMAVRALSSAGVDRSLIDGKVVAIGKDQKVVQEFLGVTVALPHAKPSLMGIIEAL
ESEQALQSKRIAVLWPKYSGLPVPPTITNFQNALSATGADVSYVYCYRTTAMSDEYYAET
ADALRSGNISAVALTSGGEAYVLSRIMKFAETQGQPVNVPIYSFGPYTTRCAEEAGLNVT
GTSPNQYSFSDFIDYLETEI
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaacgtattttatttacagctcccgacacctatcatgtaagtttgcacgaggct
tttggcaaacgccccacatgcagctttcatcccatgtttgtgccttttatcagcagtacc
ttactgccccctggtggcactttcctgccgttctgtaatcagttggcatcgtacgattat
attatctgcacaagcatcatggccgtcagggcactttcctctgctggtgtcgacagatcg
cttattgatggtaaggtagtagccataggtaaagatcagaaagtcgtgcaggagtttctg
ggtgttacagtggcattaccacatgccaaacccagtttgatggggattatcgaggctttg
gaaagcgaacaggcactacagtcgaagcgtattgctgtgctgtggcctaaatatagcgga
ctgcctgttccgccaacgatcaccaatttccagaatgccctaagcgcaacaggtgccgac
gtatcatatgtatattgctatcgtaccacagctatgagcgatgagtactatgccgaaaca
gccgatgccctacgtagcggtaatataagcgctgtagccctcaccagtggtggcgaggcc
tacgtattatcaagaattatgaaatttgccgaaacacagggccagcctgttaacgtgcct
atctactcgtttggtccttacaccacacgatgcgctgaggaggctggcttaaacgtaaca
ggcacctcccccaatcaatatagcttttctgactttattgattatctcgaaacggagata
taa

DBGET integrated database retrieval system