KEGG   Prevotella ruminicola: PRU_2751Help
Entry
PRU_2751          CDS       T01212                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
pru  Prevotella ruminicola
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pru00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PRU_2751
Enzymes [BR:pru01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     PRU_2751
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3394543..3397128)
Genome map
AA seq 861 aa AA seqDB search
MTTLDGLHWMCEMNKAEKSAAHIDYYYTVMRGDHEQRHEWLVIPHRLEFAAAKGARYMVY
DHWIDIPEDSYMYSTAFTECVAARTQKMSNLTSYGKTVRLKVRAPQLRNNERLALIGGGE
TLGNWEAKRAIDMAEHENNEWVISLDADKLPRTIEFKFVALDEEVDVTPLWENGMNRTVE
LPEIADGEVVVYELSQAYFPVYPWKGAGTVIPIFSLRSEGSFGVGDFGDLKLMIDWCDKT
KQRVLQVLPINDTNITHTWQDSYPYNSISIYALHPQYTDLRQLPQLKDEKLRQEYEVLRK
SLNALPQIDYERVNNAKMEYLRAIYAQEGAKTMKTAAFKQFFEQNKEWLVPYAAFCHYRD
LYGTATFQDWPDHHELPDSEREAMSKSTTKLYKEVAFWYYVQFNLDQQMRAAHAYARKKR
VVLKGDIPIGISRDGVEAWVEPKYFNLNGQAGAPPDAFSANGQNWGFPTYNWDAMLEDGC
SWWVRRFRKMAEYFDAYRIDHVLGFFRIWEIPIDAVHGLLGQFSPSLGMTREEIEAYGLH
FQEELFTKPFIADWTLERIFGERAQYVKDTFLDHAHDDIWQMKPEYDTQRKVEAVFKGKT
DEADLNLRDGLYALISDVLFVRDRKNKDKFHPRIGVQNDFIYEALWDNDKFVFNRLYNDY
FYRRNNQFWYTEAMKKMPRLTQATRMLVCAEDLGMVPDCVPWVMNELRILSLEIQSMPKD
PTTRFGKLSHNPYRSVDTISTHDMSTLRQWWDEDEEQTQTYYNTTLRRGGAAPHPLPGWL
AKDIVSRHLTSPSMLCLLSLQDWLSIDEGLRLPDQNAERINIPANPRHYWRYRMHLTIEQ
LLQADDFNNEISTLIIQSGRK
NT seq 2586 nt NT seq  +upstreamnt  +downstreamnt
atgacaaccctggatgggctgcactggatgtgcgaaatgaataaggcagagaaatcggct
gcccacatcgactattattataccgtgatgcgcggcgaccatgagcagcgtcacgagtgg
ctggttattccacaccgtttggagtttgctgcagccaagggagcccgttatatggtttac
gaccactggattgatatcccagaggattcgtatatgtactcgactgcttttaccgaatgt
gtggccgcccgtacacaaaaaatgagcaaccttacatcctatggcaagaccgtacgtctg
aaggttcgtgccccacagctgcgcaacaacgagcgcctggcactgattggtggcggcgag
accttaggaaactgggaggcaaagcgtgccatcgacatggctgagcacgagaacaacgaa
tgggtgatcagtcttgacgccgacaaactccctcgtaccatcgagttcaaattcgtggcc
ctcgacgaagaggtagatgtcactccattgtgggagaacggtatgaaccgtaccgttgag
ctaccggaaatagcagatggcgaggtcgttgtctatgaactgtcgcaggcctacttccct
gtctatccttggaagggtgccggtaccgttatccctatcttctcattacgcagtgagggc
agctttggtgttggcgacttcggcgacctgaagctgatgattgactggtgcgacaagacc
aagcagcgcgtactgcaagtgctgcccatcaacgataccaatatcacccacacctggcag
gattcatatccctacaactctatcagcatctatgcactgcatccgcaatacaccgatttg
cgccagctgccacagctgaaagacgaaaaactgcgccaggagtacgaggttctgcgtaaa
tcgctgaacgccctaccacaaatcgactatgagcgtgtaaacaatgccaagatggagtat
ctgcgtgccatctatgctcaggaaggtgccaagaccatgaagacggcagccttcaagcag
ttcttcgaacagaataaggagtggctggtaccttatgccgctttctgtcattaccgtgat
ctatacggcacagccacattccaagactggcccgaccatcatgagttgcccgacagcgag
cgcgaggccatgagcaagtcaacaactaagttatataaagaggtggccttctggtactat
gtacagttcaacctcgatcagcagatgcgtgccgcccatgcttatgcccgcaagaagcgc
gtggttttgaagggcgatatccccatcggcatcagtcgcgatggtgtagaggcttgggta
gagcccaagtactttaacctgaacggacaggccggtgcaccacccgatgcattctcggct
aacggacagaactggggcttccccacctacaactgggatgccatgcttgaagacggctgc
tcttggtgggttcgccgtttccgcaagatggcagagtacttcgatgcctatcgcatcgac
cacgtgttaggtttcttccgcatttgggaaatacctatcgatgccgttcacggtttgtta
ggtcagttctcgccctcactgggtatgacccgcgaggaaatcgaagcctacggtctgcac
ttccaggaagagctgttcaccaagccattcattgccgactggactttggagcgcatattt
ggcgagcgtgctcagtacgtgaaggacaccttcctggatcatgctcacgacgatatctgg
cagatgaagcccgaatacgacacccagcgtaaggttgaagccgtattcaagggcaagacc
gacgaggctgatctgaatctgcgcgatggtctatatgccctcatcagcgatgtgctcttt
gtgcgcgatcgcaagaacaaggacaagttccacccacgcatcggtgtgcagaacgacttt
atctacgaggccctttgggacaacgataagttcgtgttcaatcgtttgtacaacgactac
ttctatcgccgcaacaaccagttctggtacaccgaagcgatgaagaagatgccacgtttg
acacaggccacacgcatgctggtatgtgccgaagacctgggtatggtgcccgattgcgta
ccctgggtgatgaacgaactgcgcatcctgagcctcgaaatccagtcgatgccaaaggat
ccgactacacgcttcggcaaactgtcgcacaacccctatcgctcggtagataccatctct
acccacgatatgtcaacattgcgccaatggtgggacgaggacgaggagcagacacagact
tactataacaccactttacgtcgtggtggtgcagctccacacccactgcctggttggttg
gcaaaggacattgtgagtcgtcatctcacatcgccctctatgctctgtctgctgtcattg
caggattggctgagcatcgacgagggccttcgccttcccgaccagaatgccgagcgcatc
aacatcccggccaatccacgccactactggcgttatcgcatgcacctcactatcgagcag
ttgctgcaggccgacgacttcaataacgaaatcagcacattaattattcaaagcggaaga
aaataa

DBGET integrated database retrieval system