KEGG   Prevotella ruminicola: PRU_2769Help
Entry
PRU_2769          CDS       T01212                                 

Definition
family 2 glycosyl hydrolase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
pru  Prevotella ruminicola
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pru00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    PRU_2769
  Lipid metabolism
   00600 Sphingolipid metabolism
    PRU_2769
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    PRU_2769
Enzymes [BR:pru01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     PRU_2769
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3418328..3420835)
Genome map
AA seq 835 aa AA seqDB search
MRKIILYFARFALSLQKNNYKQQTMKLKTMIVAAIGCLLTANLNAQSVRETIRLDKGWRF
ALGNAADPQKDFGCGTEYFNYLTKANSIHNEGPYAQKFVEDNRWHEVQLPHDWVTTLPYA
AEASHSHGYKTVGYKYPETSVGWYRKTIHIPNEDLGKRLMLRFDGIFRNARVWFNGFYMG
IEPSGYATQTYDITPYIKYGDDNLICVRADATLEEGWFYEGAGIYRDVWLEKAAQVSVAP
FGTFVYAELQQPYNEAVVHVKTEVTNSSLKTQLYEVEQRILDAEGREVAHVSGFTYPILA
KETRTTDHRIKISNPHLWSTTEPYLYKVETTVKVDGKVTDVYETTTGLRDIQFTADRGFL
LNGQPLKLKGVNLHQDHAGVGAAIPDALQAWRIKQLKAFGCNAYRASHNPMTPALLDICD
REGILVIDENRLMGINDEHLRLLERMIKRDRNHPSIILWSDGNEEWGLENNIQGTRLAEA
MREYTRLYDPTRPSTVANAGGTELIKGLDVKGFNYIIQNDVDNRKKANPDWKIVGTEETT
GCGTRGIYFNNPDCKGRMVSMNRTMEQNYENIIERGWKFYDERPWAAGLFYWTGFDYRGE
PNPLSYPAHDSEFGILDYCGFWKDEAYYLKAWWTDEPTLHLLPHWNLQGHEGEEIELWAY
SNCDEVELIVNGKKLGRQAMPKNGHLKWKATYQPGKVVAIGYKNGKRTLTQTIETTKPAY
KTVLKTDRQTITADGQDLAVVTIEVQDKKGRVVPDACPMLSLRLEGDARILGVGNGDPMY
AGIDHPKELNCKTFSVPAFNGRAQVLVQSTTQKTTATLTCESGGLKNGVVIIVTK
NT seq 2508 nt NT seq  +upstreamnt  +downstreamnt
ttgcgaaaaataattttgtatttcgcgcgatttgcactatctttgcaaaaaaataactat
aaacagcaaacaatgaaacttaaaacgatgattgtagcagcgataggctgcctgctaact
gccaacttgaatgcacagagcgtacgcgaaaccatccgacttgacaagggatggcgattt
gcactgggaaacgctgccgaccctcaaaaggacttcggttgcggcacggagtattttaac
tatctgacaaaggccaactcgatacacaacgagggaccgtacgcgcagaaatttgtggag
gacaaccgttggcacgaggtgcagttgccgcacgactgggtgaccacactgccctatgcg
gccgaagccagtcactcgcacggctataagacggtgggctacaaataccctgaaaccagc
gtgggatggtatcgcaaaaccatccacatacccaacgaggatctgggcaagcgactgatg
ctgcgcttcgacggcatcttccgcaatgcccgtgtatggttcaacggcttttatatgggc
atcgaacccagcggttacgccacacagacctacgacatcacaccctatatcaaatacggc
gacgacaacctgatatgcgtgcgcgccgatgccaccctggaggaggggtggttttacgag
ggcgccggcatctatcgcgacgtgtggttggagaaagcggcacaggtcagcgtggcacct
ttcggtacgtttgtgtacgccgaactgcagcagccttacaacgaggctgtggtacatgta
aagacagaggtgaccaacagcagcttgaaaacccagctatatgaggttgagcagcgaata
ctggatgccgaaggcagagaggtggcacacgtcagcggattcacgtaccctatactcgcc
aaagaaacgcgaacaaccgatcatcggataaagatttctaatccgcacctgtggagcacc
accgaaccctatctgtataaggtggagaccacggtaaaggtagatggtaaggtaacggat
gtgtacgaaacaacaacaggtttgcgtgatatacagtttacagccgaccgtggtttcttg
ctgaacggccagcccctgaagctgaagggcgtgaacctgcatcaggaccatgcgggtgta
ggcgctgccattcccgatgccttgcaggcatggcgcattaagcagctgaaggcctttggc
tgcaatgcctatcgcgcatcgcacaaccccatgacgccagcactgctggacatctgcgac
cgcgagggcatcttagtcatcgacgagaaccgactgatgggcatcaacgacgagcatctg
cgactgctggagcggatgattaagcgcgaccgtaatcaccccagcattatcctgtggagc
gacggcaacgaggaatggggcttggaaaacaacatacagggcacacgactggccgaagcc
atgcgcgaatacaccagactgtacgaccctacacgccccagtacggtggctaatgctggc
ggtaccgagctgataaagggactggacgtgaagggatttaactacattatccagaacgat
gtggataaccgtaagaaggccaaccccgactggaagattgtgggcaccgaagagacaacg
ggctgcggcacacgcggcatctactttaacaaccccgactgcaaggggcgcatggtgagt
atgaaccgtaccatggaacagaactacgagaacatcattgagcgcggctggaagttctac
gacgagcgaccatgggctgcaggactgttctactggacgggctttgactatcgcggcgag
cccaatcccctgtcctatcctgcgcacgactcggaattcggtatcctggactactgcgga
ttctggaaagacgaggcttactatctgaaagcctggtggacggatgagcctacgctgcac
ctgctgccacactggaacctgcagggtcacgagggcgaggagatagaactgtgggcctac
agcaactgcgacgaggtagaactgatagtgaacggaaagaaactgggccgacaggcgatg
ccgaagaacgggcacctgaagtggaaagccacctaccagccaggtaaggtggtggccata
ggctacaagaacggcaagcgcacactgacacagaccatagagaccaccaagcctgcctat
aagacagtgctgaagaccgaccgacagacgattacggccgacggacaggacctggcagtg
gtgaccatcgaggtgcaggacaagaaagggcgcgtagtgcctgatgcctgtccgatgttg
agcctgcgattagagggtgatgcccgcatattaggtgtgggcaacggcgacccgatgtat
gcaggcatcgaccatcccaaggagctgaactgtaagacattcagcgtgccagcctttaac
ggcagggcacaggtgctggtgcagagcaccacacaaaaaacaaccgccaccctgacatgt
gagagtggcggcctaaagaacggagtagttattattgtaacgaaataa

DBGET integrated database retrieval system