KEGG   Prevotella ruminicola: PRU_2788Help
Entry
PRU_2788          CDS       T01212                                 

Definition
glutathione peroxidase family protein (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
pru  Prevotella ruminicola
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:pru00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:pru00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3441888..3442433
Genome map
AA seq 181 aa AA seqDB search
MSKIYDFKALTSKGKEIDFSEFQGKVLLVVNTASKCGFTPQFEGLEALNQKYKDQGLVVI
GFPCNQFKEQDPGTDSEISEFCQLNYGVTFQIMKKIDVNGAAADPIFEYLKTQAPTEEYK
GLKAKAAKALFKTISKSVEKDSDIKWNFTKFLISKDGDTIKRYAPTTEPADFEKDIEAML
G
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagatttatgatttcaaggctctgacgagcaaaggtaaggagattgatttctct
gagttccagggaaaggtgctgctggtagttaacacagccagcaagtgtggattcacccct
cagttcgaaggattggaggcgttgaaccagaagtataaggatcagggactggtggttatc
ggttttccctgcaaccagtttaaggagcaggatccaggtaccgacagcgagattagcgag
ttctgccagttgaactacggcgttaccttccagattatgaagaagattgatgtgaatggt
gctgctgccgatcctatttttgagtatctgaagacacaggctcccaccgaggagtataaa
ggtttaaaggccaaggctgccaaggctctcttcaaaaccatcagcaagagtgtagagaag
gacagcgatattaagtggaatttcaccaagttcctgatttcgaaagacggtgataccatt
aagcgctatgcacctactaccgagcctgctgactttgagaaggacattgaggccatgctt
ggttaa

DBGET integrated database retrieval system