KEGG   Psychrobacter sp. PRwf-1: PsycPRwf_0052Help
Entry
PsycPRwf_0052     CDS       T00541                                 

Definition
DNA polymerase III chi subunit, HolC
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
prw  Psychrobacter sp. PRwf-1
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:prw00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    PsycPRwf_0052
   00240 Pyrimidine metabolism
    PsycPRwf_0052
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    PsycPRwf_0052
   03430 Mismatch repair
    PsycPRwf_0052
   03440 Homologous recombination
    PsycPRwf_0052
Enzymes [BR:prw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     PsycPRwf_0052
DNA replication proteins [BR:prw03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     PsycPRwf_0052
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(65071..65571)
Genome map
AA seq 166 aa AA seqDB search
MQISFYVLGERYLNDNAAASSTASAANAEAVLNFVCRLTQTVLQKSEHSLVIIDDQVERL
KQLDTQLWSFDPVSFVAHDFILEEAAVSQLSAPVSLVSTLPKGFDGVILNLAATPLPLSV
ETTAAVLPERVLEIITPDEAGKQLGRDKYRAYQQLGFELNYFPINK
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgcaaattagtttttatgtgttgggtgagcgttatcttaacgataacgccgctgcatca
agcactgcctcagcggccaacgccgaggcagtgcttaactttgtgtgccgattgacccag
acggttttgcaaaaaagcgagcacagtttggtcatcattgacgatcaagtagagcgtctt
aaacagctcgatactcagctgtggtcttttgacccagtcagcttcgtcgctcatgatttt
atcttagaagaagccgctgtcagccagctgtcggcacctgttagcttggtatcaacgctg
cctaagggttttgatggcgttattttaaaccttgctgccactcctcttcccttatctgta
gaaacgacagccgctgtgctgccagaacgggttcttgaaatcattacccccgatgaggca
ggaaagcaacttggccgtgacaagtaccgtgcctatcagcaactaggctttgagcttaac
tattttccgatcaataaataa

DBGET integrated database retrieval system