KEGG   Psychrobacter sp. PRwf-1: PsycPRwf_0087Help
Entry
PsycPRwf_0087     CDS       T00541                                 

Definition
GDSL family lipase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
prw  Psychrobacter sp. PRwf-1
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:prw00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    PsycPRwf_0087
Enzymes [BR:prw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     PsycPRwf_0087
   3.1.2  Thioester hydrolases
    3.1.2.-  
     PsycPRwf_0087
Lipid biosynthesis proteins [BR:prw01004]
 Fatty acid synthase
  Component type
   PsycPRwf_0087
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(105835..106635)
Genome map
AA seq 266 aa AA seqDB search
MSMPFFKPLSAVVIASALLMGCQPSSNDKTATQSQAESSPTAKTQTNTSAPAASQSTTSV
QSSAPAEVMEQPITILALGDSLTEGLGLPETEAYPAQLEAALKQAGYVNAKVINSGLSGE
TSTGLVNRLDWVLKTKPDITILTTGANDAMRGIDVATIDSNIRTAIKRLQDQGSVVVLGG
MQIYDNLGDDYVKSFSAIYPNIAKDTGVVFIPFFLDGVGGDASLNQADAIHPTKEGYARI
VNNNILPVLKPALEKVAAQKQAQTAQ
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatgccgttttttaagccattatccgctgttgttattgcaagtgctctgttaatg
ggctgccagcccagctcaaatgataagacggccactcagtcacaagctgagtcttcgccc
acagccaagacccagacgaacaccagcgcacccgccgcatcacaatccaccacaagcgta
caaagtagcgccccagctgaagttatggagcagccaattaccatactggccctcggtgac
tcactcacagaaggattaggattgcccgaaactgaggcctaccccgcccaattagaagcg
gcattaaaacaggccggttatgtcaacgccaaagtcattaactctggcttaagcggcgag
accagcactggattggtgaaccgcttagactgggtattaaaaaccaaacctgacatcact
attttgaccacaggcgccaacgatgccatgcggggtatcgatgtggcgactatcgatagc
aatattcgcacggccattaagcgcttacaggaccagggcagcgtggtggtgcttggcggt
atgcaaatctatgacaacttaggggatgactacgtcaaatcgttctcggccatttatccc
aacattgctaaagacaccggtgtggtgtttattcctttctttttggacggcgttggtggt
gatgccagcctcaatcaggccgatgccattcaccccaccaaagagggctacgcgcgtatc
gtcaataacaacatcttgccggtgcttaaaccggcgcttgaaaaggtcgcagcacaaaaa
caggcccagaccgctcaatag

DBGET integrated database retrieval system