KEGG   Psychrobacter sp. PRwf-1: PsycPRwf_0135Help
Entry
PsycPRwf_0135     CDS       T00541                                 

Definition
UDP-N-acetylmuramyl tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
prw  Psychrobacter sp. PRwf-1
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:prw00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:prw00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
162117..163826
Genome map
AA seq 569 aa AA seqDB search
MTHTQPAPHLRSIVNAAVKILPQHQSTLQLLRVPAVLDVPFSKFVLDSRQLAKRDASSAP
AAFVLLKSQTQPLQKSQQYVQTALPQAAFIISEIDPQQLGLEGLDKPSDSSPDCPILFVP
DIRDVLGTLIQLSLLSDDALSQIGDAQSLAQTLPQVIAVTGTNGKTTISQLMAQLCQFSE
VAQLQNSAVMGTAGNGRLDSLVQASHTTGDALAVQGFLRKMGDEGVDLLALEASSHGLDQ
QRLQGVPVTVALYTNLSRDHLDYHPDMQDYAQAKARLFDKAYFPQLTHAVINADDEFAPL
MIETAQNSGVSVWLYSLQGDFIEKSDLQRNAYFIAKTIEPSLDGVKIEAATSFGPLTLHS
PLLGRFNVANLLAAVAGAIALGIEPESIPALVKQLHGASGRMQRVSLDEQGSQPEQGVFI
VDYAHTPDALTQVLTSLKSHCSGNLWAIFGCGGDRDKGKRPLMAQAGLATADKVVLTSDN
PRSEDPQMILQDMQQGMSDEQHAKTTVIADRKQAIEYAVEHAAADDIVVIAGKGHETYQE
IKGVRYDFDDRLVLQQALIAAHSSEASSR
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atgacacatacccaacctgctcctcacttacgctctatagttaacgccgccgtcaagata
ttaccgcagcatcagtccaccttgcagctacttagagtaccggcagtgcttgatgtgcct
ttctcaaagtttgtgctcgatagccgtcagttggcaaagcgtgacgcgtcatccgcgccg
gcagcctttgtgttattaaaaagtcagactcagcctttgcaaaaaagccagcagtatgtc
caaaccgccttaccgcaagcggcatttatcattagtgagattgacccacagcagttaggc
ttagagggattagataaaccaagcgactcaagtccagactgtcctattttatttgtgccc
gatatccgtgatgtactgggtactttgattcagttgagtcttttgtctgatgatgcgctc
tcacagatcggtgatgcacagtctttggcacaaacactgccgcaagttatcgctgtaacc
ggcaccaatggcaaaaccaccattagtcagttaatggctcagttgtgtcagttttcagag
gtcgctcaattacaaaacagtgcagtgatgggtaccgcgggtaacggtcgtctagacagt
ctcgtacaggccagccataccacaggcgatgcgctagcggtacaaggcttcttacgtaag
atgggtgatgaaggggtggatttattagccctagaggccagctcacatggtctcgatcag
cagcgcttgcaaggcgtaccagtcacggtggcactgtataccaacttaagccgtgaccat
ttagactatcacccagatatgcaagattatgcccaagccaaggcacgcttatttgataaa
gcttattttccacagttaacacatgctgtgattaatgcagatgatgagtttgcgccgctg
atgattgagacagcgcaaaactcaggggttagtgtctggttgtacagcttacagggcgat
tttatcgaaaaaagcgatctgcaacgtaatgcctactttatcgccaaaaccattgagcca
agcttagatggggtgaaaattgaggccgcaaccagctttgggccattgacgttgcacagc
cccttattaggccgctttaacgtggccaacctattggcagctgtcgccggagcgatcgcg
ttaggtatcgagcctgagagcatccccgccttagtcaaacagctgcatggtgccagtggc
cgtatgcagcgtgtgagcttagatgagcaaggctcacagcctgagcaaggggtgtttatt
gtcgattatgcgcacacgccggatgcgttaacccaagtgctgaccagtttaaaatcgcat
tgcagcggtaacttatgggccatctttggctgcggcggtgaccgtgataagggtaagcgc
cctctcatggcgcaggcgggcttggccactgccgataaagtggtattaacctctgacaat
ccgcgcagtgaagatccgcaaatgatcttgcaggacatgcagcaagggatgagtgacgag
cagcatgccaaaaccacagtcattgccgatcgaaaacaggccatcgagtatgccgtagag
cacgctgccgcagatgatatcgtggtcattgctggtaaagggcatgagacttatcaagaa
atcaaaggcgtgcgttatgacttcgatgaccgcttagtgctacagcaggcattaattgcg
gcgcacagttcagaggcctcaagccgctaa

DBGET integrated database retrieval system