KEGG   Psychrobacter sp. PRwf-1: PsycPRwf_0152Help
Entry
PsycPRwf_0152     CDS       T00541                                 

Definition
Triose-phosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
prw  Psychrobacter sp. PRwf-1
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:prw00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PsycPRwf_0152
   01230 Biosynthesis of amino acids
    PsycPRwf_0152
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PsycPRwf_0152
   00051 Fructose and mannose metabolism
    PsycPRwf_0152
   00562 Inositol phosphate metabolism
    PsycPRwf_0152
Enzymes [BR:prw01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PsycPRwf_0152
Exosome [BR:prw04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PsycPRwf_0152
  Exosomal proteins of bladder cancer cells
   PsycPRwf_0152
  Exosomal proteins of melanoma cells
   PsycPRwf_0152
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
181557..182354
Genome map
AA seq 265 aa AA seqDB search
MKSWVIGNWKLNPTSLEQVQHLVTDLVEGVDAQTRSMDNCHLMLAPSFLHLSPVQQALNA
NSSTLKLAAQDVSALSAESGAYTGDVSAKQLKDMGVQWVIVGHSERRQYYKESNAVLLKK
LLNSAEQGLGVILCIGESESDFEAGHTEQVLDEELQVIADFLQQLKPEQAGYAEQNLIIA
YEPVWAIGTGKVPSVEQVTQIHRFIRQQLHSFDNKLDTTPVIYGGSVKPENAADFAASDQ
INGVLVGGAALQADSFLAIAKCFNN
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcttgggttatcggaaactggaagctaaatcctacgtcgcttgagcaagtacag
cacttggtgacagacttagtagaaggcgttgacgctcaaacccgcagcatggataattgc
catcttatgttggccccaagctttttacatttaagcccagtgcagcaggcacttaacgcc
aactcatctactcttaagctggctgcgcaagatgtgagcgcactcagtgctgaatcaggg
gcttatactggtgatgtttcggctaagcagctaaaagatatgggcgtacagtgggtgatt
gtcggtcactctgagcgccgtcagtactataaagaaagcaacgccgtactgctaaaaaag
ctgcttaatagcgctgagcaaggcttgggcgtgattttgtgcattggtgagtcagagagc
gactttgaggcgggtcacactgagcaagtgttggatgaggagttacaagttattgctgac
tttttacagcaattaaagcctgagcaggcgggatatgccgagcaaaacctgattatcgct
tatgagccggtgtgggccattggtaccggtaaggtgccaagtgtagagcaggtgacgcaa
atacatcgctttatccgtcagcagttgcattcatttgataataagcttgataccacccca
gtgatttatggtggcagcgttaagcctgagaatgctgcagattttgctgcctcagaccag
atcaatggggtgttggttggcggcgccgccctgcaggcagacagctttcttgcgattgct
aaatgctttaataactag

DBGET integrated database retrieval system