KEGG   Psychrobacter sp. PRwf-1: PsycPRwf_0152Help
Entry
PsycPRwf_0152     CDS       T00541                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
prw  Psychrobacter sp. PRwf-1
Pathway
prw00010  Glycolysis / Gluconeogenesis
prw00051  Fructose and mannose metabolism
prw00562  Inositol phosphate metabolism
prw01100  Metabolic pathways
prw01110  Biosynthesis of secondary metabolites
prw01120  Microbial metabolism in diverse environments
prw01130  Biosynthesis of antibiotics
prw01200  Carbon metabolism
prw01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:prw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PsycPRwf_0152
   00051 Fructose and mannose metabolism
    PsycPRwf_0152
   00562 Inositol phosphate metabolism
    PsycPRwf_0152
Enzymes [BR:prw01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PsycPRwf_0152
Exosome [BR:prw04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PsycPRwf_0152
  Exosomal proteins of bladder cancer cells
   PsycPRwf_0152
  Exosomal proteins of melanoma cells
   PsycPRwf_0152
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABQ93112
JGI: PsycPRwf0152
UniProt: A5WBS1
Position
181557..182354
Genome map
AA seq 265 aa AA seqDB search
MKSWVIGNWKLNPTSLEQVQHLVTDLVEGVDAQTRSMDNCHLMLAPSFLHLSPVQQALNA
NSSTLKLAAQDVSALSAESGAYTGDVSAKQLKDMGVQWVIVGHSERRQYYKESNAVLLKK
LLNSAEQGLGVILCIGESESDFEAGHTEQVLDEELQVIADFLQQLKPEQAGYAEQNLIIA
YEPVWAIGTGKVPSVEQVTQIHRFIRQQLHSFDNKLDTTPVIYGGSVKPENAADFAASDQ
INGVLVGGAALQADSFLAIAKCFNN
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcttgggttatcggaaactggaagctaaatcctacgtcgcttgagcaagtacag
cacttggtgacagacttagtagaaggcgttgacgctcaaacccgcagcatggataattgc
catcttatgttggccccaagctttttacatttaagcccagtgcagcaggcacttaacgcc
aactcatctactcttaagctggctgcgcaagatgtgagcgcactcagtgctgaatcaggg
gcttatactggtgatgtttcggctaagcagctaaaagatatgggcgtacagtgggtgatt
gtcggtcactctgagcgccgtcagtactataaagaaagcaacgccgtactgctaaaaaag
ctgcttaatagcgctgagcaaggcttgggcgtgattttgtgcattggtgagtcagagagc
gactttgaggcgggtcacactgagcaagtgttggatgaggagttacaagttattgctgac
tttttacagcaattaaagcctgagcaggcgggatatgccgagcaaaacctgattatcgct
tatgagccggtgtgggccattggtaccggtaaggtgccaagtgtagagcaggtgacgcaa
atacatcgctttatccgtcagcagttgcattcatttgataataagcttgataccacccca
gtgatttatggtggcagcgttaagcctgagaatgctgcagattttgctgcctcagaccag
atcaatggggtgttggttggcggcgccgccctgcaggcagacagctttcttgcgattgct
aaatgctttaataactag

DBGET integrated database retrieval system