KEGG   Psychrobacter sp. PRwf-1: PsycPRwf_0262Help
Entry
PsycPRwf_0262     CDS       T00541                                 

Definition
succinate dehydrogenase, hydrophobic membrane anchor
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
prw  Psychrobacter sp. PRwf-1
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:prw00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PsycPRwf_0262
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PsycPRwf_0262
   00650 Butanoate metabolism
    PsycPRwf_0262
  Energy metabolism
   00190 Oxidative phosphorylation
    PsycPRwf_0262
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
308608..308991
Genome map
AA seq 127 aa AA seqDB search
MRRNDSGIKSATGLTGSGSRDWVMQRISAVVLAIYAVVMVGFFLINGDVSYQQWVSFIMS
LPMRLLSLVAIIALAAHAWVGMWTVFTDYVKSTGLRLVLQAAMIIAILVYLFWGVMIFWG
PGLLNLG
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgagaagaaatgattctggaattaaaagtgcgacaggcctaaccggctcaggctcgcgc
gactgggtaatgcagcgtatcagtgccgtcgtattggccatatatgctgtggtaatggta
gggtttttcttaattaatggtgatgtatcctaccagcagtgggttagcttcattatgagc
ctgcccatgcgcctattaagcttggtcgcaattattgcgctagcggctcatgcttgggta
gggatgtggacggtatttaccgactatgttaaatctactggcctacgccttgtgcttcaa
gctgctatgattatcgcaattttggtatacctattctggggcgtcatgattttctggggt
ccaggtttactaaacctaggttaa

DBGET integrated database retrieval system