KEGG   Psychrobacter sp. PRwf-1: PsycPRwf_0267Help
Entry
PsycPRwf_0267     CDS       T00541                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E2 component
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
prw  Psychrobacter sp. PRwf-1
Pathway
prw00020  Citrate cycle (TCA cycle)
prw00310  Lysine degradation
prw01100  Metabolic pathways
prw01110  Biosynthesis of secondary metabolites
prw01120  Microbial metabolism in diverse environments
prw01130  Biosynthesis of antibiotics
prw01200  Carbon metabolism
Module
prw_M00009  Citrate cycle (TCA cycle, Krebs cycle)
prw_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:prw00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PsycPRwf_0267
  Amino acid metabolism
   00310 Lysine degradation
    PsycPRwf_0267
Enzymes [BR:prw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     PsycPRwf_0267
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 GCV_H RnfC_N
Motif
Other DBs
NCBI-ProteinID: ABQ93222
JGI: PsycPRwf0267
UniProt: A5WC31
Position
316529..317758
Genome map
AA seq 409 aa AA seqDB search
MAEIKAPVFPESVADGTIVEWHVSEGEQVNRDDILAEIETDKVVLEVVAPDDGVVTKIVK
QVDDTVLSDELIAEFEAGATGSAAGASEDKAEESSDTATEEKPAAKPAASADSADDHKDQ
SPAVRKAAKESGVDPKNVEGTGRGGRVTKQDMASPTLKADSSIKSDSGRPVAESVGERTE
KRVPMTRLRKTVANRLLAASQETAMLTTFNEVNMKPLMDLRAKYKDQFEKRHGTRLGFMS
MFVKAATEALKRFPAVNASIDGDDIVYHGYYDVGVAVSSDRGLVVPVLRDTDRMSMADIE
GGIRDFAGKARDGKLSLQEMTGGTFTITNGGVFGSLMSTPILNPPQTAILGMHAINERPM
AVNGQVEILPMMYLALSYDHRMIDGKDAVQFLVTIKQLVEDPAMLLLDL
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaattaaagcgcccgtattcccagagtcagttgctgacggtaccatcgtagaa
tggcacgtaagcgaaggcgaacaagttaaccgtgatgacattttagctgaaatcgaaaca
gataaagtggtcttagaagtggttgctccagatgacggtgtggtaactaaaattgttaag
caagtagacgacactgtgttgtctgacgagctaatcgctgaatttgaagctggtgcaaca
ggcagcgctgctggtgcttctgaagacaaagcagaagaaagcagtgacacggctactgaa
gaaaaaccagcagctaagcctgccgcaagcgctgacagcgccgatgatcataaagatcaa
agcccagcggttcgtaaagcagccaaagagtctggtgtagatcctaaaaatgtagaaggc
acaggccgtggcggtcgtgtgactaagcaagatatggccagcccaacactgaaagcggat
agctctatcaagtctgacagtggccgtcctgtcgcagaatcagtaggtgagcgtactgaa
aaacgcgtgcctatgactcgtctacgtaagactgtggccaaccgtctgttagccgcttct
caagaaactgcgatgttgaccacgttcaacgaagtgaatatgaagcctctaatggatcta
cgtgctaagtacaaagatcagtttgaaaaacgtcacggcactcgtctaggctttatgtct
atgttcgttaaagccgctaccgaagcactaaaacgcttcccagctgttaacgcgtcaatc
gacggtgatgacatcgtttatcacggttactatgacgttggtgttgcggtatcttcagac
cgtggtctagtggtgcctgtactacgtgatacagatcgtatgagcatggcagacatcgaa
ggcggcatccgcgacttcgctggtaaagcccgtgatggtaaattatcactacaagagatg
acaggtggtaccttcacgatcactaacggtggtgtatttggttcattaatgtcaacgcct
atcttgaacccaccccaaactgccatcttaggtatgcacgcgatcaatgagcgcccaatg
gcggttaatggtcaagttgagatcctacctatgatgtatctagcgttatcatacgatcac
cgtatgattgatggtaaagatgcggtacagttcttagtcaccatcaagcagttggttgaa
gacccagcaatgctactacttgacctataa

DBGET integrated database retrieval system