KEGG   Psychrobacter sp. PRwf-1: PsycPRwf_0269Help
Entry
PsycPRwf_0269     CDS       T00541                                 

Definition
(GenBank) succinyl-CoA synthetase (ADP-forming) beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
prw  Psychrobacter sp. PRwf-1
Pathway
prw00020  Citrate cycle (TCA cycle)
prw00640  Propanoate metabolism
prw00660  C5-Branched dibasic acid metabolism
prw01100  Metabolic pathways
prw01110  Biosynthesis of secondary metabolites
prw01120  Microbial metabolism in diverse environments
prw01130  Biosynthesis of antibiotics
prw01200  Carbon metabolism
Module
prw_M00009  Citrate cycle (TCA cycle, Krebs cycle)
prw_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:prw00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PsycPRwf_0269
   00640 Propanoate metabolism
    PsycPRwf_0269
   00660 C5-Branched dibasic acid metabolism
    PsycPRwf_0269
Enzymes [BR:prw01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     PsycPRwf_0269
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: ABQ93224
JGI: PsycPRwf0269
UniProt: A5WC33
Position
319653..320822
Genome map
AA seq 389 aa AA seqDB search
MNLHEYQAKLLLESYGLPIQKGIIAYNGEEAAEAFDKTPTDVAVIKAQVHAGGRGKAGGV
KLVKTREEAKEVAESLIGTNLVTYQTDAEGQPVNFVLVAEDMYPVKTELYLGAVVDRATR
RVTFMASTEGGVEIEKVAEETPEKIFSITVDPLVGLLPFQAREVGFKLGLEGKQINQFVK
LMTGAYKAFVENDFDMIEINPLAVRENGELACVDGKIGVDSNALFRQPKIAALHDPSQEN
ERELKAAEFDLNYVALEGNIGCMVNGAGLAMATMDIIKLYGGKPANFLDVGGGATKDRVV
EAFKIILEDSSVQGVLINIFGGIVRCDMIAEAIIAAVKEVNVTVPVVVRLEGNNAELGAK
LLDESDVEIISAQGLSDAAQKIVDAVKAA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaatttacatgagtatcaagcaaaactattgctagagagctatggactacctatccaa
aaaggcatcattgcttataacggtgaagaagcggctgaagcctttgataaaaccccaact
gacgtagccgtaattaaagcacaggttcatgctggtggccgtggtaaagcaggcggtgtt
aagcttgttaaaactcgtgaagaagccaaagaagttgctgaaagcttaatcggtactaac
ctagtgacttaccaaactgatgcagaaggccagcctgtaaacttcgtattggttgccgaa
gacatgtacccagtaaaaactgagttatatcttggtgccgttgttgaccgcgctactcgc
cgcgtaaccttcatggcctcaactgaaggtggtgttgagattgaaaaagtagctgaagag
actcctgagaaaatctttagtattaccgttgatcctttagtcggtctattgcctttccaa
gcgcgtgaagtaggtttcaaattgggcctagaaggcaaacaaatcaaccaattcgttaaa
ctaatgactggcgcttacaaagcgttcgttgaaaacgactttgacatgattgaaatcaac
ccactagccgttcgtgaaaatggtgaattggcttgtgttgacggcaaaatcggcgtggat
tcaaacgctttattccgtcagccaaaaatcgcagcacttcatgacccatcacaagagaac
gagcgtgagcttaaagctgctgaatttgacctaaactatgtggctctagaaggtaacatt
ggttgtatggttaacggtgccggtcttgctatggcgactatggacatcatcaagctatac
ggcggcaagccagctaacttcctagacgttggcggcggcgcaaccaaagatcgcgttgtt
gaagctttcaaaatcatcttagaagattcaagcgtacaaggcgttctaatcaacatcttc
ggtggtatcgtacgttgtgacatgattgctgaagccattatcgcggcagttaaagaagtt
aacgttactgtacctgttgtggttcgcttagaaggtaacaatgctgaattgggcgctaag
ctattagatgagtctgacgttgaaatcatttcagctcaaggcctatctgatgctgcacaa
aaaattgttgatgctgtaaaagcggcataa

DBGET integrated database retrieval system