KEGG   Psychrobacter sp. PRwf-1: PsycPRwf_0269Help
Entry
PsycPRwf_0269     CDS       T00541                                 

Gene name
sucC
Definition
succinyl-CoA synthetase subunit beta
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
prw  Psychrobacter sp. PRwf-1
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:prw00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PsycPRwf_0269 (sucC)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PsycPRwf_0269 (sucC)
   00640 Propanoate metabolism
    PsycPRwf_0269 (sucC)
   00660 C5-Branched dibasic acid metabolism
    PsycPRwf_0269 (sucC)
Enzymes [BR:prw01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     PsycPRwf_0269 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
319653..320822
Genome map
AA seq 389 aa AA seqDB search
MNLHEYQAKLLLESYGLPIQKGIIAYNGEEAAEAFDKTPTDVAVIKAQVHAGGRGKAGGV
KLVKTREEAKEVAESLIGTNLVTYQTDAEGQPVNFVLVAEDMYPVKTELYLGAVVDRATR
RVTFMASTEGGVEIEKVAEETPEKIFSITVDPLVGLLPFQAREVGFKLGLEGKQINQFVK
LMTGAYKAFVENDFDMIEINPLAVRENGELACVDGKIGVDSNALFRQPKIAALHDPSQEN
ERELKAAEFDLNYVALEGNIGCMVNGAGLAMATMDIIKLYGGKPANFLDVGGGATKDRVV
EAFKIILEDSSVQGVLINIFGGIVRCDMIAEAIIAAVKEVNVTVPVVVRLEGNNAELGAK
LLDESDVEIISAQGLSDAAQKIVDAVKAA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaatttacatgagtatcaagcaaaactattgctagagagctatggactacctatccaa
aaaggcatcattgcttataacggtgaagaagcggctgaagcctttgataaaaccccaact
gacgtagccgtaattaaagcacaggttcatgctggtggccgtggtaaagcaggcggtgtt
aagcttgttaaaactcgtgaagaagccaaagaagttgctgaaagcttaatcggtactaac
ctagtgacttaccaaactgatgcagaaggccagcctgtaaacttcgtattggttgccgaa
gacatgtacccagtaaaaactgagttatatcttggtgccgttgttgaccgcgctactcgc
cgcgtaaccttcatggcctcaactgaaggtggtgttgagattgaaaaagtagctgaagag
actcctgagaaaatctttagtattaccgttgatcctttagtcggtctattgcctttccaa
gcgcgtgaagtaggtttcaaattgggcctagaaggcaaacaaatcaaccaattcgttaaa
ctaatgactggcgcttacaaagcgttcgttgaaaacgactttgacatgattgaaatcaac
ccactagccgttcgtgaaaatggtgaattggcttgtgttgacggcaaaatcggcgtggat
tcaaacgctttattccgtcagccaaaaatcgcagcacttcatgacccatcacaagagaac
gagcgtgagcttaaagctgctgaatttgacctaaactatgtggctctagaaggtaacatt
ggttgtatggttaacggtgccggtcttgctatggcgactatggacatcatcaagctatac
ggcggcaagccagctaacttcctagacgttggcggcggcgcaaccaaagatcgcgttgtt
gaagctttcaaaatcatcttagaagattcaagcgtacaaggcgttctaatcaacatcttc
ggtggtatcgtacgttgtgacatgattgctgaagccattatcgcggcagttaaagaagtt
aacgttactgtacctgttgtggttcgcttagaaggtaacaatgctgaattgggcgctaag
ctattagatgagtctgacgttgaaatcatttcagctcaaggcctatctgatgctgcacaa
aaaattgttgatgctgtaaaagcggcataa

DBGET integrated database retrieval system