KEGG   Psychrobacter sp. PRwf-1: PsycPRwf_0271Help
Entry
PsycPRwf_0271     CDS       T00541                                 

Definition
(GenBank) UDP-glucose pyrophosphorylase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
prw  Psychrobacter sp. PRwf-1
Pathway
prw00040  Pentose and glucuronate interconversions
prw00052  Galactose metabolism
prw00500  Starch and sucrose metabolism
prw00520  Amino sugar and nucleotide sugar metabolism
prw01100  Metabolic pathways
prw01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:prw00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PsycPRwf_0271
   00052 Galactose metabolism
    PsycPRwf_0271
   00500 Starch and sucrose metabolism
    PsycPRwf_0271
   00520 Amino sugar and nucleotide sugar metabolism
    PsycPRwf_0271
Enzymes [BR:prw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     PsycPRwf_0271
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD
Motif
Other DBs
NCBI-ProteinID: ABQ93226
JGI: PsycPRwf0271
UniProt: A5WC35
Position
321963..322841
Genome map
AA seq 292 aa AA seqDB search
MLMTTHVTHAVIPVAGFGTRMLPLSKSVPKELLPLGNRPAIHYVVEEAIAAGIKHIVLVG
HAQKSAIENYFDVNAELDNQLRAKGKDELADSLNWLPEDVSVSVIRQGKPLGLGHAVLKA
RPIVGDNPFAVLLPDVVLNPFTTKMDKDNLAYMIQAFAQTHHSQILVSHVADEDVQKYGI
AKLKDADQLSQLTGDKNANFAVAGFVEKPQLADAPSNLAVVGRYVFNAAIFDYLANTQPS
VGGEIQLTDAIDALISTQGVDVTTMLGDSFDAGDMTSYMQAFIYFAQQQLQA
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgcttatgaccactcacgttactcatgccgttatccctgttgccggcttcggtacccgt
atgttgcctttatcaaagtctgtgcccaaagagctgctaccacttggcaatcgtccagcc
attcattatgtggtagaagaggcgatagcggccggtattaaacatattgtgctggtgggt
catgctcaaaaaagcgccattgagaactactttgatgtcaatgctgagcttgataatcaa
ttgcgcgctaagggaaaagatgagctggccgatagcctaaactggctgcctgaggatgtc
tcagtatctgtgattcgtcaaggcaagcccttaggtttgggtcatgcggttttaaaggcg
cgtcctattgtcggtgacaatccttttgcagtgctgctacccgatgtggtgctaaaccca
tttactaccaagatggataaagacaatctggcctatatgatacaagcctttgcgcaaacc
catcactcacaaatcctagttagccatgttgctgatgaggatgtacaaaaatatggcatt
gctaagctaaaagatgctgatcaattgtcgcagctaacaggagacaaaaacgccaatttc
gcagtggcaggttttgtcgaaaagccgcagttagcagatgctccctctaatctggcggta
gtgggccgctatgtatttaacgccgctatctttgactacttggccaatactcagccctct
gtgggcggtgagattcagctaacggacgccattgatgcgcttattagtactcaaggtgtt
gatgtcacgaccatgctcggtgatagctttgatgccggtgatatgaccagctatatgcag
gcctttatttactttgctcagcagcagctacaagcctaa

DBGET integrated database retrieval system