KEGG   Psychrobacter sp. PRwf-1: PsycPRwf_0271Help
Entry
PsycPRwf_0271     CDS       T00541                                 

Definition
nucleotidyl transferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
prw  Psychrobacter sp. PRwf-1
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:prw00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PsycPRwf_0271
   00052 Galactose metabolism
    PsycPRwf_0271
   00500 Starch and sucrose metabolism
    PsycPRwf_0271
   00520 Amino sugar and nucleotide sugar metabolism
    PsycPRwf_0271
Enzymes [BR:prw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     PsycPRwf_0271
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
321963..322841
Genome map
AA seq 292 aa AA seqDB search
MLMTTHVTHAVIPVAGFGTRMLPLSKSVPKELLPLGNRPAIHYVVEEAIAAGIKHIVLVG
HAQKSAIENYFDVNAELDNQLRAKGKDELADSLNWLPEDVSVSVIRQGKPLGLGHAVLKA
RPIVGDNPFAVLLPDVVLNPFTTKMDKDNLAYMIQAFAQTHHSQILVSHVADEDVQKYGI
AKLKDADQLSQLTGDKNANFAVAGFVEKPQLADAPSNLAVVGRYVFNAAIFDYLANTQPS
VGGEIQLTDAIDALISTQGVDVTTMLGDSFDAGDMTSYMQAFIYFAQQQLQA
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgcttatgaccactcacgttactcatgccgttatccctgttgccggcttcggtacccgt
atgttgcctttatcaaagtctgtgcccaaagagctgctaccacttggcaatcgtccagcc
attcattatgtggtagaagaggcgatagcggccggtattaaacatattgtgctggtgggt
catgctcaaaaaagcgccattgagaactactttgatgtcaatgctgagcttgataatcaa
ttgcgcgctaagggaaaagatgagctggccgatagcctaaactggctgcctgaggatgtc
tcagtatctgtgattcgtcaaggcaagcccttaggtttgggtcatgcggttttaaaggcg
cgtcctattgtcggtgacaatccttttgcagtgctgctacccgatgtggtgctaaaccca
tttactaccaagatggataaagacaatctggcctatatgatacaagcctttgcgcaaacc
catcactcacaaatcctagttagccatgttgctgatgaggatgtacaaaaatatggcatt
gctaagctaaaagatgctgatcaattgtcgcagctaacaggagacaaaaacgccaatttc
gcagtggcaggttttgtcgaaaagccgcagttagcagatgctccctctaatctggcggta
gtgggccgctatgtatttaacgccgctatctttgactacttggccaatactcagccctct
gtgggcggtgagattcagctaacggacgccattgatgcgcttattagtactcaaggtgtt
gatgtcacgaccatgctcggtgatagctttgatgccggtgatatgaccagctatatgcag
gcctttatttactttgctcagcagcagctacaagcctaa

DBGET integrated database retrieval system