KEGG   Psychrobacter sp. PRwf-1: PsycPRwf_0314Help
Entry
PsycPRwf_0314     CDS       T00541                                 

Definition
(GenBank) Beta-N-acetylhexosaminidase
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
prw  Psychrobacter sp. PRwf-1
Pathway
prw00520  Amino sugar and nucleotide sugar metabolism
prw01100  Metabolic pathways
prw01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:prw00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PsycPRwf_0314
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    PsycPRwf_0314
Enzymes [BR:prw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     PsycPRwf_0314
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3 Herpes_UL36
Motif
Other DBs
NCBI-ProteinID: ABQ93269
JGI: PsycPRwf0314
UniProt: A5WC78
Position
complement(375637..376707)
Genome map
AA seq 356 aa AA seqDB search
MYGPLMIDVAGTELTAEDRDVLSCEQVGGVILFARNVETPEQVRRLCDEIHQQQPDIIIG
VDQEGGRVARLRQGFTPLPAMGKLGDLFDSDPCGALSLAYDCGYLMAAEVMAVGIDISFA
PVLDINGVSQVIGDRSFHARTEAIVALSSQFMRGMKAAGMATTGKHFPGHGSIAPDSHVA
DVIDNRSFEQIKAVDLQPFIQCQPWLDALMPAHVIFSQVDDKPAGFSKVWLQDIAREQLG
FNGVLFSDDLSMKAAHVAGDVSARVTAALEAGCDMALVCNDREAALQAIQTSAQLPKPNQ
TRLEAMRSQLPTWQGSLEATCAQFDYWAVAKQNITQAFFNEPLVAAQATDPTDYKR
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgtatgggccattaatgatagatgtggcaggcaccgaactgactgccgaagatcgcgac
gtcctaagctgtgagcaggtggggggtgttattttatttgcccgtaatgtcgagaccccc
gagcaagtacgacggttatgtgatgagattcatcaacagcagcccgatatcatcatcggt
gtcgatcaagaaggcggacgggtggcaagactgcgtcaaggctttaccccgctaccagca
atgggaaaactgggtgatttatttgattcagacccttgtggggcgcttagcttggcttac
gactgcggctatcttatggccgcagaggtcatggcggtgggcattgacataagctttgcg
cccgtgcttgatatcaatggggtcagtcaagttatcggcgatcgcagctttcatgcgcgc
accgaagccatcgtggcgctttcttctcagtttatgcgaggtatgaaagctgcaggcatg
gcaaccacaggcaagcactttccaggtcatggttccattgcccctgattcacatgtggca
gatgtcattgacaatcgcagctttgagcagattaaagcggtagacctgcagccctttatt
cagtgtcagccttggcttgatgcccttatgcccgcccatgttatcttctctcaagtagat
gataagccggcaggattctccaaagtatggctacaagacattgcccgagagcaattgggc
ttcaatggggtgttattctcagatgacttatctatgaaagcggcacacgtggccggtgat
gtcagtgctcgagttaccgcagctttagaagctggctgcgacatggccttagtgtgtaat
gatagagaggcagcgctgcaagccatacagacctcagcccagttgcccaagcccaatcaa
acccggcttgaagcgatgcgtagtcagctgcctacttggcaaggctcactagaggccact
tgcgcccaatttgattattgggcagtggcgaaacaaaatattacgcaggctttttttaac
gaaccattagtggctgcgcaagcaaccgatcccactgattataagcgctaa

DBGET integrated database retrieval system