KEGG   Psychrobacter sp. PRwf-1: PsycPRwf_0488Help
Entry
PsycPRwf_0488     CDS       T00541                                 

Definition
class I cytochrome c
Orthology
K08738  
cytochrome c
Organism
prw  Psychrobacter sp. PRwf-1
Pathway
Sulfur metabolism
Two-component system
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:prw00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:prw02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
581680..582189
Genome map
AA seq 169 aa AA seqDB search
MSLCVHSSAGAKRLASAFGIKKSVALLAMAGFVALGSGCTPTPPDYRPQVTAPAYQGGDA
QKGEKLYEDNCTQCHTIRPGSNKKGPQLLGVYMAPSAQLKDYKYSEAMSHANWVWDAKTL
DKYIADPEAVLPDTRMLSDPMPNTQDRQDIIAYLSTLGHDAPPVPEEKK
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgtctttatgtgttcattcatcagcgggtgctaagcgcctagcgagtgcttttggtatt
aaaaaatcagtggctttattggcgatggctggctttgtggccttagggagtggctgtacg
ccgaccccgccggattacaggccgcaagttactgcgcccgcttatcaaggcggggatgcc
caaaaaggcgagaagctatacgaggataactgtactcagtgccacaccattcgcccagga
agcaataaaaaagggcctcagttattgggggtgtatatggcgccatcagctcagctaaaa
gactataaatacagtgaagcgatgagccatgccaattgggtatgggatgccaaaaccttg
gacaaatatattgccgatccagaggcagtgctaccagacacacgtatgctttctgacccc
atgccaaacacccaagatcgacaggatattattgcttatctatcgacactgggtcatgat
gcgccgccagtgcccgaggaaaaaaagtag

DBGET integrated database retrieval system