KEGG   Psychrobacter sp. PRwf-1: PsycPRwf_0536Help
Entry
PsycPRwf_0536     CDS       T00541                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
prw  Psychrobacter sp. PRwf-1
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:prw00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PsycPRwf_0536
Enzymes [BR:prw01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     PsycPRwf_0536
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
640968..641879
Genome map
AA seq 303 aa AA seqDB search
MQLHCLPNIKIKAPLSTKPGIASGYKQLDLSEPQVMGILNVTPDSFSDGGQFNNIESAIR
HCERMIQEGATIIDIGGESTRPNASPVSEEEECARVVPVVAAIRERFGDKLWLSIDTSSP
TVIEQAVHAGADIWNDVRALTREGALEMAAKLDIPVVLMHMRGEPTTMNAKAHYQDVISE
VLAELKVRIEAAQQAGVKAHNLIIDPGFGFAKEYEHHKRLLNHMSQLHQLQLPILFGVSR
KRFLGQVLTHTGLGIFDDHMATDRDGVGMVAALLAVQQGASIIRTHNVRLSVEGLALWQQ
LSQ
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgcaactacattgtcttcctaatattaaaattaaagcgcctttatctaccaagccaggt
atcgctagcggctataaacagctagacttgtctgagcctcaagtaatgggtattttgaat
gtgacccctgactcgttttctgatggtgggcagtttaataatatcgagtcggctatacgg
cactgtgaacgcatgattcaagagggtgccactattattgatatcggcggagaatcaact
cggccaaatgccagtccagtgagcgaagaagaagaatgcgcgcgcgtagtgcctgtggtt
gcagcgattcgtgaacgcttcggtgataagctgtggctgtctattgataccagctcaccg
acagtgattgaacaggcggtgcacgcgggtgctgacatctggaatgatgtgcgagcattg
actcgggagggcgcacttgagatggcggccaagctcgatatccctgtggtactgatgcac
atgcgcggtgaacctactaccatgaatgccaaagcccattatcaagatgtgatcagtgaa
gtacttgctgagcttaaggtacgaattgaggcagctcagcaagctggcgtaaaagcacat
aatctcattattgatccaggcttcggctttgctaaagagtatgagcaccacaagcggtta
ttaaatcatatgtcgcagttgcatcaattgcagttgcccatcttattcggtgtctcacgt
aagcgctttttaggtcaggtgctgacccataccggcctcggtatctttgatgatcatatg
gcaactgatagagatggcgtgggtatggttgcagcattattagcagtacagcaaggcgct
agtattatacgcactcataatgtcagattaagcgtagagggtctggctttgtggcagcaa
ttgagccaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system