KEGG   Psychrobacter sp. PRwf-1: PsycPRwf_0577Help
Entry
PsycPRwf_0577     CDS       T00541                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
prw  Psychrobacter sp. PRwf-1
Pathway
prw00230  Purine metabolism
prw01100  Metabolic pathways
Module
prw_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:prw00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    PsycPRwf_0577
Enzymes [BR:prw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     PsycPRwf_0577
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin MMR_HSR1 AAA_33 AAA_18 AAA_22 MobB AAA_19 AAA_16 ATP-synt_ab AAA_25 cobW RsgA_GTPase NTPase_1
Motif
Other DBs
NCBI-ProteinID: ABQ93532
JGI: PsycPRwf0577
UniProt: A5WCZ1
Position
complement(694250..694864)
Genome map
AA seq 204 aa AA seqDB search
MKGSLFIITAASGTGKTSLVKQLIATTNDLAVSVSHTTREPRPGEIHGQHYHFTDTAKFI
EGIQAGEFLEHAQVFDNYYGTSRQSVNQQLESGVDVILEIDWQGALQVKELYEDVTMIFI
LPPSQATLRQRLSSRGQDSQEVIEKRLAGAVTEMQQYVHFDYVVINDQFEAALSELKAII
VAKRQTLARQQARYAEVIKDLITE
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggctccctttttattatcacagccgcttcaggcacaggtaagacatctttagtt
aaacagcttatcgccaccaccaatgatttggctgtcagcgtctcacacaccacccgcgag
ccgcgtcccggtgaaatccatggccagcactatcattttaccgatacagccaagtttatc
gagggcattcaggccggtgagtttttggagcatgcgcaggtttttgataattattatggc
acgtcacgccaaagcgtaaaccagcagcttgagtctggggtcgatgtgatcttagagatt
gactggcaaggcgcgttacaggttaaagagctgtatgaggatgtgaccatgatttttatt
ttgccaccaagccaggccacgttacgtcagcgcctctcctcacgtggtcaagactcccaa
gaggtaatcgaaaagcgcttggctggtgcggtgactgaaatgcagcaatacgtgcacttc
gattatgtggtgattaatgatcaatttgaagccgctttgtctgagttaaaagcaattatt
gtggccaagcgtcaaacgctcgcccgccagcaagcgcgttatgctgaagttatcaaagac
ttaatcactgaataa

DBGET integrated database retrieval system