KEGG   Psychrobacter sp. PRwf-1: PsycPRwf_0642Help
Entry
PsycPRwf_0642     CDS       T00541                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
prw  Psychrobacter sp. PRwf-1
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:prw01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:prw00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(771864..773072)
Genome map
AA seq 402 aa AA seqDB search
MHTSDPSNTATDHQQQTLELSIELMRRDSVTPHDKGCQEVLVERLSPLGFVHEFMYFGDE
QASGRDAQVKNLWARRGNQDPVVCFAGHTDVVPTGNPDNWRIAPFDAKVHDGYLWGRGAA
DMKTGIAAFTVATERFVKNHPDHNGSIAMLITSDEEGPSINGTVKVIEVLEARNEKITYC
LVGEPSSTDSLGDVIKNGRRGSLGGILTVTGKQGHVAYPHLAVNPIHALLPALAEFSVTE
WDKGNDFFPATSMQISNINGGTGANNVIPETVEVVFNFRFSTETTEEELRAKTHEILDKH
FANTEATYEIDWKLSGHPFLTAEGKLVDACKVAIKDITGTDTQLSTSGGTSDGRFIAPTG
AQVVELGVRNATIHQVDERVEIDDIGKLAQIYERMLEELLLG
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgcacacaagcgacccatcgaataccgccactgaccatcagcaacaaaccttagagctt
agtattgagctgatgcgccgagactctgtgacacctcacgataaaggctgtcaggaggta
ttggttgagcgtttaagcccgcttggatttgtgcatgagtttatgtattttggtgatgag
caagccagcggacgcgatgcacaggtaaaaaacctatgggccagacgtggcaaccaagac
cctgtggtgtgcttcgccggccataccgatgtggtgcctaccggtaatccggacaattgg
cgcattgcgccttttgacgccaaagtacatgatggctacctttggggacgtggtgcggct
gatatgaaaaccggtattgccgcctttactgtcgctactgagcgctttgtcaaaaaccat
cctgaccataatggctcaatcgccatgctgattacctcagatgaagaaggcccatcaatt
aatggtacggttaaagtgattgaggttttagaagcacgaaatgagaaaataacctattgc
ttagtcggtgagccatcaagtacagacagcttaggtgatgtgatcaaaaatgggcgccgt
ggctcgttgggcggtattttaacggtgaccggcaaacaaggccatgtcgcctaccctcat
ttagcggttaatccaattcacgctttattgcctgctttggctgagtttagcgttactgaa
tgggacaaaggcaatgactttttcccagcaacgtcgatgcaaatctcaaacatcaacggt
ggtactggtgcaaacaatgtgattccagaaaccgttgaagtggtgtttaactttagattc
tcgactgaaaccaccgaagaagaattacgcgccaaaacccatgaaatcttggacaagcac
tttgccaatactgaggctacctatgagattgactggaaattatcaggccatccgttctta
actgctgaaggcaagctggtagatgcgtgtaaagtagccattaaagacattaccggtacc
gacactcagttatcgacctcgggcggtacttctgacggccgctttattgcgccaactggt
gcgcaagtggtcgagcttggcgtgcgtaatgcgaccattcatcaggtggatgagcgtgtg
gagattgatgatattggtaaattggctcagatttatgagcgtatgctagaagagttgttg
ctgggttag

DBGET integrated database retrieval system