KEGG   Psychrobacter sp. PRwf-1: PsycPRwf_0915Help
Entry
PsycPRwf_0915     CDS       T00541                                 

Definition
S-adenosyl-L-homocysteine hydrolase
Orthology
K01251  
adenosylhomocysteinase [EC:3.3.1.1]
Organism
prw  Psychrobacter sp. PRwf-1
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:prw00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    PsycPRwf_0915
Enzymes [BR:prw01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.1  Thioether and trialkylsulfonium hydrolases
    3.3.1.1  adenosylhomocysteinase
     PsycPRwf_0915
Protein phosphatases and associated proteins [BR:prw01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     PsycPRwf_0915
Exosome [BR:prw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PsycPRwf_0915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1091801..1093222)
Genome map
AA seq 473 aa AA seqDB search
MDAVSNVDSKTNLENFHDYKVADISLADYGRREIALAEAEMPALMGLRKRYSEAQPLAGA
KILGCIHMTIQTAVLIETLVALGAEVRWTSCNIFSTQDHAAAAIAASGVPVFAWKGETEE
EYEWCLRQQLFVGGEENGQLWDANLILDDGGDLTALIHNDYPQMLETINGISEETTTGVH
RLIDMLNKGTLKVPAINVNDAVTKSKNDNKYGCRHSLNDAIKRATDMLLAGRRALVIGYG
DVGKGSAQSLRQEGMIVRVSEVDPICAMQACMDGYELVSPYIDGKNTDSAEGINTRLLQD
TDLIVTTTGNYHVCDKHMLAALKSGAVVCNIGHFDTEIDTQFMRDTWNWVEIKPQVHQVY
RSEDQSDYLILLAEGRLVNLGNATGHPSRVMDGSFANQVLAQMYLHQEKFSELPADERAK
GLYVKVLPKKLDEEVAAAMVAGFNGVMTQLTPEQAEYLGVPVEGPFKADDYKY
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atggacgcagtgtctaacgtcgattcaaaaaccaatttagaaaacttccatgactataaa
gtcgccgatatcagcctagccgattacggccgccgtgagattgctttagctgaagctgaa
atgcccgccttaatgggcctacgcaagcgctacagcgaagcacagcctctagcaggtgcc
aagattcttggttgtattcatatgaccatccaaaccgccgtactgatcgaaactttagtc
gctctgggtgctgaagtacgctggacatcatgtaatatcttctcaactcaagaccatgca
gcagcggctattgcggccagcggcgtaccggtattcgcttggaaaggcgaaactgaagaa
gagtacgagtggtgcttacgtcaacaattatttgtcggcggtgaagaaaacggccagctt
tgggatgccaacttaatcttagatgatggcggtgacctaacagcgctgattcacaatgac
tacccacaaatgcttgagaccatcaatggtatctcagaagagaccaccactggggtacat
cgcctaatcgatatgcttaataaaggcactctaaaagtacctgccattaacgtaaacgat
gcggttactaagtctaaaaacgacaacaaatatggttgccgtcatagcttaaacgatgcc
atcaaacgtgccactgatatgttacttgccggacgccgtgctctggttatcggctatggc
gatgtgggtaaaggctcagcgcaaagcttacgtcaagaaggcatgattgtacgtgtctca
gaagtagaccctatctgtgctatgcaggcctgtatggacggctatgagttagtatctccc
tatattgatggtaaaaatactgattcagcagaaggcatcaacactcgcctattacaagac
accgaccttattgtcaccacgacaggtaactaccatgtgtgtgataagcacatgcttgct
gctctaaaatcaggcgctgtggtctgtaatatcggtcatttcgacactgaaattgacact
cagttcatgcgtgatacttggaactgggtagaaatcaaaccacaagttcaccaagtgtat
cgctcagaagatcaaagcgattacctcatcttattggcagaaggccgcctagtaaaccta
ggtaacgccaccggtcacccatcacgtgtcatggatggttcattcgctaaccaagtcttg
gctcaaatgtacttacaccaagaaaaattctctgagctacccgctgatgagcgcgctaag
ggtctatacgtaaaagtattaccaaaaaaacttgatgaggaagtagccgccgctatggta
gctggcttcaatggcgttatgacccaactaaccccagagcaagcagagtatctaggtgtg
ccggttgaaggtccatttaaagctgatgactataagtactaa

DBGET integrated database retrieval system