KEGG   Psychrobacter sp. PRwf-1: PsycPRwf_0915Help
Entry
PsycPRwf_0915     CDS       T00541                                 

Definition
S-adenosyl-L-homocysteine hydrolase
Orthology
K01251  
adenosylhomocysteinase [EC:3.3.1.1]
Organism
prw  Psychrobacter sp. PRwf-1
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:prw00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1091801..1093222)
Genome map
AA seq 473 aa AA seqDB search
MDAVSNVDSKTNLENFHDYKVADISLADYGRREIALAEAEMPALMGLRKRYSEAQPLAGA
KILGCIHMTIQTAVLIETLVALGAEVRWTSCNIFSTQDHAAAAIAASGVPVFAWKGETEE
EYEWCLRQQLFVGGEENGQLWDANLILDDGGDLTALIHNDYPQMLETINGISEETTTGVH
RLIDMLNKGTLKVPAINVNDAVTKSKNDNKYGCRHSLNDAIKRATDMLLAGRRALVIGYG
DVGKGSAQSLRQEGMIVRVSEVDPICAMQACMDGYELVSPYIDGKNTDSAEGINTRLLQD
TDLIVTTTGNYHVCDKHMLAALKSGAVVCNIGHFDTEIDTQFMRDTWNWVEIKPQVHQVY
RSEDQSDYLILLAEGRLVNLGNATGHPSRVMDGSFANQVLAQMYLHQEKFSELPADERAK
GLYVKVLPKKLDEEVAAAMVAGFNGVMTQLTPEQAEYLGVPVEGPFKADDYKY
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atggacgcagtgtctaacgtcgattcaaaaaccaatttagaaaacttccatgactataaa
gtcgccgatatcagcctagccgattacggccgccgtgagattgctttagctgaagctgaa
atgcccgccttaatgggcctacgcaagcgctacagcgaagcacagcctctagcaggtgcc
aagattcttggttgtattcatatgaccatccaaaccgccgtactgatcgaaactttagtc
gctctgggtgctgaagtacgctggacatcatgtaatatcttctcaactcaagaccatgca
gcagcggctattgcggccagcggcgtaccggtattcgcttggaaaggcgaaactgaagaa
gagtacgagtggtgcttacgtcaacaattatttgtcggcggtgaagaaaacggccagctt
tgggatgccaacttaatcttagatgatggcggtgacctaacagcgctgattcacaatgac
tacccacaaatgcttgagaccatcaatggtatctcagaagagaccaccactggggtacat
cgcctaatcgatatgcttaataaaggcactctaaaagtacctgccattaacgtaaacgat
gcggttactaagtctaaaaacgacaacaaatatggttgccgtcatagcttaaacgatgcc
atcaaacgtgccactgatatgttacttgccggacgccgtgctctggttatcggctatggc
gatgtgggtaaaggctcagcgcaaagcttacgtcaagaaggcatgattgtacgtgtctca
gaagtagaccctatctgtgctatgcaggcctgtatggacggctatgagttagtatctccc
tatattgatggtaaaaatactgattcagcagaaggcatcaacactcgcctattacaagac
accgaccttattgtcaccacgacaggtaactaccatgtgtgtgataagcacatgcttgct
gctctaaaatcaggcgctgtggtctgtaatatcggtcatttcgacactgaaattgacact
cagttcatgcgtgatacttggaactgggtagaaatcaaaccacaagttcaccaagtgtat
cgctcagaagatcaaagcgattacctcatcttattggcagaaggccgcctagtaaaccta
ggtaacgccaccggtcacccatcacgtgtcatggatggttcattcgctaaccaagtcttg
gctcaaatgtacttacaccaagaaaaattctctgagctacccgctgatgagcgcgctaag
ggtctatacgtaaaagtattaccaaaaaaacttgatgaggaagtagccgccgctatggta
gctggcttcaatggcgttatgacccaactaaccccagagcaagcagagtatctaggtgtg
ccggttgaaggtccatttaaagctgatgactataagtactaa

DBGET integrated database retrieval system