KEGG   Psychrobacter sp. PRwf-1: PsycPRwf_0955Help
Entry
PsycPRwf_0955     CDS       T00541                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
prw  Psychrobacter sp. PRwf-1
Pathway
prw00790  Folate biosynthesis
prw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:prw00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PsycPRwf_0955
Enzymes [BR:prw01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     PsycPRwf_0955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI PHY DUF3684 Spore_YhcN_YlaJ
Motif
Other DBs
NCBI-ProteinID: ABQ93905
JGI: PsycPRwf0955
UniProt: A5WE14
Position
complement(1142206..1142811)
Genome map
AA seq 201 aa AA seqDB search
MCDSNSNSLNTALDPRLPSPDLYAKLIASTGEDLNRPGLLDTPTRAAKAFGYLTQGYHQS
LTEVTNNAVFPTDNSELVLVHNIEFYSLCEHHLLPFHGVAHVGYLPDGKVLGLSKVARII
DMYARRLQIQESLSQQVAEAIMEVTQCRGVAVVMDASHMCMMMRGVNKQLSSTRTTAMLG
DFKTDMQARNEFFAALPASKL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgattctaattcaaattctttaaatactgccctagatcccagactgcccagtcct
gatctttatgccaaattaatcgcctctactggagaagatttaaatcgaccaggcttacta
gatacgcctactcgcgccgccaaggcatttggttatttaacccaaggatatcatcaatca
ctcactgaagtgaccaataatgcggtattccctacggataactctgagttggtattggtg
cataatattgagttttactcattgtgtgagcatcacttgctgccgtttcatggtgtcgct
catgtgggctacttaccagatggcaaagtactgggcttatccaaagtggcacgcattatc
gatatgtatgcccgccgcttacaaatccaagaaagcttaagccaacaagtcgctgaagcc
atcatggaggtgactcagtgccgcggcgtagctgtagttatggacgcctcgcacatgtgt
atgatgatgcgtggggtcaataagcagttatctagcacccgtaccacagccatgctaggc
gactttaagacggatatgcaagcccgcaacgaattctttgctgcgctgccggcctcaaag
ctttaa

DBGET integrated database retrieval system