KEGG   Psychrobacter sp. PRwf-1: PsycPRwf_1108Help
Entry
PsycPRwf_1108     CDS       T00541                                 

Definition
phosphoadenosine phosphosulfate reductase
Orthology
K00390  
phosphoadenosine phosphosulfate reductase [EC:1.8.4.8]
Organism
prw  Psychrobacter sp. PRwf-1
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:prw00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    PsycPRwf_1108
Enzymes [BR:prw01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.8  phosphoadenylyl-sulfate reductase (thioredoxin)
     PsycPRwf_1108
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1361295..1361924)
Genome map
AA seq 209 aa AA seqDB search
MTIEINIDQANQELQGKTPEQIVEWALAKAENPIITTNFRPYESAILHLVAKQKPDITVL
WVDSGYNTRATYDFANKLIKDLNLNVVTYIPKQTSAHRDATMNGIPSVNNPLHDEFTEQV
KLEPFKRALAELKPDVWFNAIRKDQTEFRQGLDVLSQSKDGVLKVAPLFYKNDKDLDAYL
AEHDLPNEFDYFDPTKVEENRECGLHTQL
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcgaaatcaatatcgaccaagccaaccaagagcttcaaggcaaaacccctgag
caaatcgttgagtgggcgcttgccaaagccgaaaacccaatcatcaccaccaacttccgt
ccttatgagtcagccatcttacatttagtggccaagcaaaagccggatatcactgtactt
tgggtagactcaggctacaacacacgtgccacttatgacttcgctaacaagctgattaaa
gatctaaacctaaacgtagtgacttatattcctaagcaaaccagcgcccatcgtgacgcc
accatgaacggtattccaagcgtgaataacccactacatgacgaattcactgagcaggta
aaacttgagccatttaagcgtgctttggctgagttaaagcctgatgtgtggttcaatgcc
atccgcaaagaccaaaccgaatttcgtcaaggtcttgatgtgcttagccagtcaaaagac
ggcgtattaaaagtcgcgcctttgttctacaaaaacgataaagacttagacgcttactta
gcagagcatgacctgcccaatgagtttgattattttgatccgaccaaagttgaagaaaac
cgtgagtgtggtctacacactcagctgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system