KEGG   Psychrobacter sp. PRwf-1: PsycPRwf_1108Help
Entry
PsycPRwf_1108     CDS       T00541                                 

Definition
phosphoadenosine phosphosulfate reductase
Orthology
K00390  
phosphoadenosine phosphosulfate reductase [EC:1.8.4.8]
Organism
prw  Psychrobacter sp. PRwf-1
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:prw00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1361295..1361924)
Genome map
AA seq 209 aa AA seqDB search
MTIEINIDQANQELQGKTPEQIVEWALAKAENPIITTNFRPYESAILHLVAKQKPDITVL
WVDSGYNTRATYDFANKLIKDLNLNVVTYIPKQTSAHRDATMNGIPSVNNPLHDEFTEQV
KLEPFKRALAELKPDVWFNAIRKDQTEFRQGLDVLSQSKDGVLKVAPLFYKNDKDLDAYL
AEHDLPNEFDYFDPTKVEENRECGLHTQL
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcgaaatcaatatcgaccaagccaaccaagagcttcaaggcaaaacccctgag
caaatcgttgagtgggcgcttgccaaagccgaaaacccaatcatcaccaccaacttccgt
ccttatgagtcagccatcttacatttagtggccaagcaaaagccggatatcactgtactt
tgggtagactcaggctacaacacacgtgccacttatgacttcgctaacaagctgattaaa
gatctaaacctaaacgtagtgacttatattcctaagcaaaccagcgcccatcgtgacgcc
accatgaacggtattccaagcgtgaataacccactacatgacgaattcactgagcaggta
aaacttgagccatttaagcgtgctttggctgagttaaagcctgatgtgtggttcaatgcc
atccgcaaagaccaaaccgaatttcgtcaaggtcttgatgtgcttagccagtcaaaagac
ggcgtattaaaagtcgcgcctttgttctacaaaaacgataaagacttagacgcttactta
gcagagcatgacctgcccaatgagtttgattattttgatccgaccaaagttgaagaaaac
cgtgagtgtggtctacacactcagctgtaa

DBGET integrated database retrieval system