KEGG   Psychrobacter sp. PRwf-1: PsycPRwf_1211Help
Entry
PsycPRwf_1211     CDS       T00541                                 

Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
prw  Psychrobacter sp. PRwf-1
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:prw00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PsycPRwf_1211
Enzymes [BR:prw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     PsycPRwf_1211
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1481693..1484056)
Genome map
AA seq 787 aa AA seqDB search
MKSNNNTATMRVEESWADTISDYILQRRAQTYAAYVQPSDTNTSTNFVETDSYLFKSLFM
VLAKQLEEGHTVLTLRQNSTELALQGRVAGKAAKLYAWQRDILQSLAGPLFDLIDSDAAL
AAIAQSQEDTQGELAHSEDSDPIFNLLNILMTRGNELWLQLSLPNSSKAQLVERFKLVQQ
LYELMQNDNKADVLSEKGLINSLSKFMQHVDQHPLFTQMSSALLAKENSLSKNIPISKQT
PIIYQSNHPHNNHLNKHLETDKKITFWLHRTWQAEFNLAKTIQNILNQPIKPLDIHIPDN
LNAQQVQAVKVANENAFSIITGGPGTGKTYTVAQLVIALQQAQANSDAQQALGEGSTIRF
STDSAGLALSAPTGKAAQRMQESLQAALDNAQVEVQLQEAKTIHRLLGIGRDGRPRYHAG
NPLGEDIIIVDEASMLGVELANYLVSAIKPGARLILLGDANQLAAVDAGAVLADLCRIDV
LQPIHAQLTESRRFHADSGIGKLATQINTTPTDMQQVWQLLTHDEALQFQSVNIQLGSDA
TDREADDVETAVFNHQLINSLSNKKIISKLSQNYLPYLNKIHQLIKHPIAKSVPEAVSLT
VSELMSKFNRFRILTAGHNGEWGDHNINDYLTRWHMTQLKLPLGKSPWFHGRPVMVLQNN
YELGLFNGDIGICLQTQQKGEGGRLEVFFENKIQGIAVNLLNDELIATAYAMTIHKSQGS
EFDHVAVTFDNSNSRLLSKELIYTAVTRAKKKVSIFSTKRALQKAVQTPTQRYTGLALQF
EQKAAVD
NT seq 2364 nt NT seq  +upstreamnt  +downstreamnt
atgaaatccaataacaatacggcaactatgcgcgttgaagagagctgggctgataccatt
agtgactatattttacagcgccgagctcagacgtatgcggcatatgtacagccaagtgac
accaacacgtcaacaaattttgtagagactgacagttatttatttaaatcgctgtttatg
gtgttggctaagcagttggaggaggggcatactgtattaactctgcgccaaaatagtact
gagctggcattacagggcagggtagcaggcaaggcagctaagctttatgcgtggcagcgc
gatattctacaaagtttggcagggcctttgtttgatctgattgacagtgatgcggctttg
gctgctatcgcacagtcgcaagaggatactcaaggcgagcttgcgcactctgaggacagt
gatcctatctttaacctacttaatattttgatgacccgtggtaatgagctgtggttacag
ttaagcctacctaatagcagtaaagctcagctggttgagcgttttaagttggttcagcag
ctatacgagttaatgcaaaatgataataaggcagatgtgttaagtgaaaaagggttgata
aatagcctaagcaaatttatgcaacatgtagatcagcaccctttatttacccagatgtca
tcggcactgctagccaaagaaaatagcctaagcaaaaatatcccaatttcaaaacaaaca
cccatcatttaccaaagcaatcacccgcacaacaatcatttaaacaagcacttagagaca
gacaaaaaaataactttctggctgcatcgtacttggcaagctgagtttaacctcgctaaa
accatacaaaatatcttaaaccaaccaataaaacccttagatatccatattcctgacaat
ctcaatgctcagcaggtacaagcagttaaagtcgctaatgagaacgcttttagcatcatc
acgggcggtcccggtacgggaaaaacctataccgtggcacagcttgtgattgccttacag
caggctcaggcaaatagcgatgcacagcaagcattaggggagggctctacgattagattt
agtacagacagcgcagggcttgctctatcggcaccaacgggtaaagcggcacagcgtatg
caagaatcactgcaagcggctttagacaacgctcaagtagaggtgcagctgcaagaagca
aagaccattcaccgtctgctggggatcggtagagatggcagaccacgctatcatgcaggt
aatcctttgggggaggacatcattattgtcgatgaagcctcaatgctcggcgtagagttg
gccaattacttagtgagcgccattaagccaggggcaaggctaatcttattaggggatgcc
aatcagctggccgcagtggatgccggggcagtactcgccgacttatgccgtattgatgta
ttgcagcccattcatgcacagctgacagagagccgccgcttccatgccgactcgggtatt
ggtaaattggccacgcagattaatacaacaccaacggacatgcagcaggtgtggcagcta
ttaacccatgacgaggcgttacagttccaaagcgttaacattcaactgggcagtgatgct
actgatagggaggctgacgatgtagagacggctgtttttaatcatcaattaataaatagc
ctaagcaataaaaaaatcatttcaaagctgtcccaaaactaccttccatatttaaataaa
atccatcaactaataaaacatcccatagcaaaatccgtgccagaagcagtaagccttact
gtttctgagcttatgagtaagtttaaccgatttcgtatcttaactgccggacacaatggg
gagtggggagatcataatatcaatgactatctgacccgctggcatatgacgcagcttaag
ctgcctttgggcaaaagtccttggtttcatggtagaccggttatggtgttacagaataat
tatgagctgggtctatttaacggagatattggtatttgtttgcagacacagcaaaaaggt
gagggtggccgtttagaggtattttttgagaataagatccaaggtattgcggtcaatttg
cttaatgatgagctgattgctaccgcgtatgccatgactattcacaagtcgcaaggctct
gaatttgatcatgttgcagttacctttgataatagcaacagccgactgcttagcaaagag
ctgatttatactgcagtgacccgcgctaagaaaaaggtaagtatttttagtaccaaacgt
gcgttacaaaaagcggtgcagacgccgacgcagcgctatacaggtcttgctttacaattt
gagcaaaaggcggctgttgattaa

DBGET integrated database retrieval system