KEGG   Psychrobacter sp. PRwf-1: PsycPRwf_1403Help
Entry
PsycPRwf_1403     CDS       T00541                                 

Definition
pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
prw  Psychrobacter sp. PRwf-1
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:prw00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PsycPRwf_1403
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PsycPRwf_1403
   00020 Citrate cycle (TCA cycle)
    PsycPRwf_1403
   00620 Pyruvate metabolism
    PsycPRwf_1403
Enzymes [BR:prw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     PsycPRwf_1403
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1722528..1724213)
Genome map
AA seq 561 aa AA seqDB search
MEIKAPDLGVDSAEVSEIMVSVGDVITENDNIVLLESDKAAVEVPSSASGTVTKIVVSLG
DTVSEGSVLIEIEADAAQTDSQPKAEPEAEAEPEQAPQEASQPEAQTQTQAADKPAAATS
QTYPLPDLGVDEAEIAEIMVSVGDSVEAEQSLLLVESDKASVEVPSPVSGVVEKILVAAG
DKVANGQDFIVIKAAGAPEAAASAAPAKSESESNKALPQAQDKPESAKQAAPKPTAQNQS
QAPAKLSEQQVNAKLTDVYAGPAVRKLARQLGVDITQVEGTALNARILKEDVFDYVKAHM
QTGSAAASTGAVVSSGLPSLPDMSKTDIWGEIETQDLSRLQKVSIPQLNYNTYLPQVTQF
DLSDITETEKLRGELKGEFKAQGIGLTILAFIVKATAYALMQHPKFNSHLSDDNTQIHIR
KTVNMGIAVATDDGLIVPVIKDAQDKGIKQIAIEIGELAAKARDKKLGAKDLQGASFTIS
SQGNLGGTYFTPLVNWPQVGILGVSEATMQPRWNEKTQNFEPRLMLPLSLSYDHRVINGA
DAAVFTRYIAKLLADPRRILL
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atggaaattaaagcccccgatctaggtgtggatagtgccgaagtaagcgagattatggtc
tcggtcggcgatgtcattacagaaaatgataatattgtcttattagagtcagacaaagct
gcggtagaagtgcccagctcagccagtggtactgtgactaagattgtggtgtcacttggt
gatacggttagcgaaggctcagtacttattgagattgaagcagacgctgcacagacagac
tcacagcctaaagctgagccagaagctgaagctgagcctgagcaagcaccacaagaagca
tcacagcctgaagctcaaactcaaacacaagcagcagataagccggctgctgccacttct
cagacctatccgctaccagacctgggtgtggatgaagctgagattgctgagattatggtc
agcgtcggtgatagcgtagaagctgagcagtctttattattggtagaatcagacaaagcc
tctgttgaagtaccatcgccagtatccggcgttgtcgagaagattttggtggccgctggt
gataaagtagccaacggtcaagattttattgtcattaaggcagcaggtgcgccagaagct
gctgcaagcgccgcgccggctaagtcagaaagcgagtcgaataaagcgctgcctcaagca
caagataagcctgagagcgccaagcaagccgcaccaaaaccaacagcgcaaaatcaaagt
caggcaccagcgaagcttagtgagcagcaagtcaatgccaagcttaccgatgtctatgca
ggacctgcggtgcgtaagcttgcgcgtcagctaggcgtagatatcactcaagtagagggc
acagcgcttaatgcacgcatcttaaaagaagatgtgtttgattacgtaaaagcccatatg
caaacgggctctgccgctgcatctactggtgctgtagtcagctcaggtctgccaagttta
ccagacatgagtaagacagatatctggggtgagattgagacccaagacttaagtcgcctg
caaaaagtgtctataccgcagctaaattacaacacttatttgccgcaggtgactcagttt
gacttatctgatattactgagactgagaaactgcgtggtgagttaaaaggtgaatttaag
gcgcaaggcattggcttaacaatcctagctttcatcgtcaaagccaccgcctacgcattg
atgcagcatcctaagttcaacagtcacctaagtgatgataatactcaaattcatattaga
aaaacggtgaatatgggtattgcggttgcgacagatgatggtttgattgtgccggtcatt
aaagatgctcaagacaaaggcattaaacagatcgccatcgaaattggtgagctggctgcc
aaagcgcgtgataagaagttgggtgccaaagacttacaaggtgcaagctttactatctca
agtcaaggtaacctaggcggtacttactttacgccgctggtcaactggccacaagtgggc
atcttaggggtttctgaagcgaccatgcagcctcgctggaatgaaaaaacacaaaacttt
gagccacgcttaatgctgccgctgtctttgtcgtatgatcaccgcgttattaatggtgca
gatgccgctgtatttacccgctacattgctaagctgttggcagacccaagacgtattttg
ctatag

  All links  
No link information was found.   
DBGET integrated database retrieval system