KEGG   Psychrobacter sp. PRwf-1: PsycPRwf_1403Help
Entry
PsycPRwf_1403     CDS       T00541                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
prw  Psychrobacter sp. PRwf-1
Pathway
prw00010  Glycolysis / Gluconeogenesis
prw00020  Citrate cycle (TCA cycle)
prw00620  Pyruvate metabolism
prw01100  Metabolic pathways
prw01110  Biosynthesis of secondary metabolites
prw01120  Microbial metabolism in diverse environments
prw01130  Biosynthesis of antibiotics
prw01200  Carbon metabolism
Module
prw_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:prw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PsycPRwf_1403
   00020 Citrate cycle (TCA cycle)
    PsycPRwf_1403
   00620 Pyruvate metabolism
    PsycPRwf_1403
Enzymes [BR:prw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     PsycPRwf_1403
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H RnfC_N HlyD_D23 NQRA Trypan_PARP
Motif
Other DBs
NCBI-ProteinID: ABQ94348
JGI: PsycPRwf1403
UniProt: A5WFA7
Position
complement(1722528..1724213)
Genome map
AA seq 561 aa AA seqDB search
MEIKAPDLGVDSAEVSEIMVSVGDVITENDNIVLLESDKAAVEVPSSASGTVTKIVVSLG
DTVSEGSVLIEIEADAAQTDSQPKAEPEAEAEPEQAPQEASQPEAQTQTQAADKPAAATS
QTYPLPDLGVDEAEIAEIMVSVGDSVEAEQSLLLVESDKASVEVPSPVSGVVEKILVAAG
DKVANGQDFIVIKAAGAPEAAASAAPAKSESESNKALPQAQDKPESAKQAAPKPTAQNQS
QAPAKLSEQQVNAKLTDVYAGPAVRKLARQLGVDITQVEGTALNARILKEDVFDYVKAHM
QTGSAAASTGAVVSSGLPSLPDMSKTDIWGEIETQDLSRLQKVSIPQLNYNTYLPQVTQF
DLSDITETEKLRGELKGEFKAQGIGLTILAFIVKATAYALMQHPKFNSHLSDDNTQIHIR
KTVNMGIAVATDDGLIVPVIKDAQDKGIKQIAIEIGELAAKARDKKLGAKDLQGASFTIS
SQGNLGGTYFTPLVNWPQVGILGVSEATMQPRWNEKTQNFEPRLMLPLSLSYDHRVINGA
DAAVFTRYIAKLLADPRRILL
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atggaaattaaagcccccgatctaggtgtggatagtgccgaagtaagcgagattatggtc
tcggtcggcgatgtcattacagaaaatgataatattgtcttattagagtcagacaaagct
gcggtagaagtgcccagctcagccagtggtactgtgactaagattgtggtgtcacttggt
gatacggttagcgaaggctcagtacttattgagattgaagcagacgctgcacagacagac
tcacagcctaaagctgagccagaagctgaagctgagcctgagcaagcaccacaagaagca
tcacagcctgaagctcaaactcaaacacaagcagcagataagccggctgctgccacttct
cagacctatccgctaccagacctgggtgtggatgaagctgagattgctgagattatggtc
agcgtcggtgatagcgtagaagctgagcagtctttattattggtagaatcagacaaagcc
tctgttgaagtaccatcgccagtatccggcgttgtcgagaagattttggtggccgctggt
gataaagtagccaacggtcaagattttattgtcattaaggcagcaggtgcgccagaagct
gctgcaagcgccgcgccggctaagtcagaaagcgagtcgaataaagcgctgcctcaagca
caagataagcctgagagcgccaagcaagccgcaccaaaaccaacagcgcaaaatcaaagt
caggcaccagcgaagcttagtgagcagcaagtcaatgccaagcttaccgatgtctatgca
ggacctgcggtgcgtaagcttgcgcgtcagctaggcgtagatatcactcaagtagagggc
acagcgcttaatgcacgcatcttaaaagaagatgtgtttgattacgtaaaagcccatatg
caaacgggctctgccgctgcatctactggtgctgtagtcagctcaggtctgccaagttta
ccagacatgagtaagacagatatctggggtgagattgagacccaagacttaagtcgcctg
caaaaagtgtctataccgcagctaaattacaacacttatttgccgcaggtgactcagttt
gacttatctgatattactgagactgagaaactgcgtggtgagttaaaaggtgaatttaag
gcgcaaggcattggcttaacaatcctagctttcatcgtcaaagccaccgcctacgcattg
atgcagcatcctaagttcaacagtcacctaagtgatgataatactcaaattcatattaga
aaaacggtgaatatgggtattgcggttgcgacagatgatggtttgattgtgccggtcatt
aaagatgctcaagacaaaggcattaaacagatcgccatcgaaattggtgagctggctgcc
aaagcgcgtgataagaagttgggtgccaaagacttacaaggtgcaagctttactatctca
agtcaaggtaacctaggcggtacttactttacgccgctggtcaactggccacaagtgggc
atcttaggggtttctgaagcgaccatgcagcctcgctggaatgaaaaaacacaaaacttt
gagccacgcttaatgctgccgctgtctttgtcgtatgatcaccgcgttattaatggtgca
gatgccgctgtatttacccgctacattgctaagctgttggcagacccaagacgtattttg
ctatag

DBGET integrated database retrieval system