KEGG   Psychrobacter sp. PRwf-1: PsycPRwf_1448Help
Entry
PsycPRwf_1448     CDS       T00541                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
prw  Psychrobacter sp. PRwf-1
Pathway
prw00630  Glyoxylate and dicarboxylate metabolism
prw01100  Metabolic pathways
prw01110  Biosynthesis of secondary metabolites
prw01120  Microbial metabolism in diverse environments
prw01200  Carbon metabolism
Module
prw_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:prw00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    PsycPRwf_1448
Enzymes [BR:prw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     PsycPRwf_1448
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase Lipase_GDSL_2
Motif
Other DBs
NCBI-ProteinID: ABQ94393
JGI: PsycPRwf1448
UniProt: A5WFF2
Position
1773186..1774769
Genome map
AA seq 527 aa AA seqDB search
MSTYKSAIDHIREIKAKHGNWQNISESDAARMMVQNRFKTGLDIAKYTAAIMRKDMAEYD
ADTSKYTQSLGAWHGFVAQQTMYAKKKYFGTTAKTYIYLSGWMVAALRSELGPLPDQSMH
EKTTVPALIEEIYTFLRQADAKVLNDYFRELNAAKEAGQDTSEIEEKINNFDSHVVPIIA
DIDAGFGNEEATYLLTKAMIEAGACAIQIENQVSDAKQCGHQAGKVTVPHEDFISKLNAI
RYAFLELGVDDGVIVARTDSEGASLTQKIPVSEEPGDLASKYIDFIDVEEIDIADAKEND
VLLKRDGKLVRPVRLANGLYQFREDTNIDRVVLDCVTALENGADLLWIETPTPDVAHIKM
MVDRIKEQQPKAKLVYNNSPSFNWTLNFRKQVIAQWEEEGKDISAYDKNNLMSADYDGTE
LDAAADQAAKNFQKDASREAGVFHHLITLPTYHTTALSVHELAKGYFGEDGMLAYAAGVQ
RKEIREGISCVKHQAMAGSDLGDDHKEIFSGDNALKAGGEKNTMNQF
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacttataaatcagctattgaccatatccgtgaaattaaagcaaagcatggcaac
tggcagaatatcagcgaatctgatgctgctcgtatgatggttcaaaaccgcttcaaaacc
ggtcttgatatcgctaaatacacggctgctatcatgcgtaaagatatggcagagtatgat
gcagatacatctaagtacactcagtctctaggcgcatggcatggttttgttgcacaacaa
actatgtatgctaagaaaaaatacttcggtacgactgctaaaacctacatctacctatca
ggctggatggtagcggctctacgctcagagcttggccctttacctgaccaatcaatgcac
gaaaaaacaacggttcctgcgctaatcgaagaaatctacaccttcttacgtcaagcagac
gcgaaagtattaaatgattatttccgtgagcttaacgctgctaaagaagccggtcaagat
acttctgaaatcgaagaaaaaatcaataactttgattcacacgttgtgccaatcatcgct
gacatcgacgcaggtttcggtaacgaagaagcaacttacttacttactaaagccatgatc
gaagcgggtgcttgtgctatccagatcgaaaaccaagtatctgatgcaaaacaatgtggt
caccaagccggtaaagtcactgtaccacatgaagacttcatctctaagcttaacgctatc
cgttatgcattcttagagctaggcgttgatgatggtgttatcgttgcccgtaccgactca
gaaggtgcatcacttactcaaaagatcccagtatctgaagagccaggcgaccttgcttct
aaatacatcgacttcatcgacgttgaagaaatcgacatcgctgatgccaaagaaaacgac
gtactattaaagcgtgacggtaaattagttcgcccagttcgtctagctaacggtctatac
cagttccgtgaagataccaacatcgaccgcgttgtacttgactgtgtaaccgctcttgaa
aatggtgctgaccttctatggatcgaaacaccgactccagatgttgcacacatcaaaatg
atggttgaccgtattaaagagcagcagcctaaagcgaagcttgtatacaacaacagccca
tcatttaactggacgctaaacttccgtaagcaagtgattgctcagtgggaagaagaaggc
aaagacatctcagcatacgacaagaacaacttgatgagtgctgattatgatggtactgag
cttgacgctgctgctgaccaagctgcgaagaacttccagaaagatgcgtcacgtgaagcc
ggtgtattccatcacctaatcacgctaccaacttaccacaccacagcacttagcgttcat
gagcttgctaaaggctacttcggtgaagacggtatgcttgcttatgcagctggcgtacaa
cgtaaagaaatccgtgaaggcatctcttgcgttaagcaccaagcaatggccggttcagac
ttaggtgatgatcacaaagagattttctctggtgacaacgcacttaaagctggcggcgag
aaaaacacaatgaaccagttctaa

DBGET integrated database retrieval system