KEGG   Psychrobacter sp. PRwf-1: PsycPRwf_1460Help
Entry
PsycPRwf_1460     CDS       T00541                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K06001  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
prw  Psychrobacter sp. PRwf-1
Pathway
prw00260  Glycine, serine and threonine metabolism
prw00400  Phenylalanine, tyrosine and tryptophan biosynthesis
prw01100  Metabolic pathways
prw01110  Biosynthesis of secondary metabolites
prw01130  Biosynthesis of antibiotics
prw01230  Biosynthesis of amino acids
Module
prw_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:prw00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PsycPRwf_1460
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PsycPRwf_1460
Enzymes [BR:prw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PsycPRwf_1460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABQ94405
JGI: PsycPRwf1460
UniProt: A5WFG4
Position
complement(1790372..1791592)
Genome map
AA seq 406 aa AA seqDB search
MTQIKDSYGLHASTLPDTQGLYGEFGGKISHPELARALDELETGFREIIKNDDFIAEMKR
LRETYVGRPSPIYHAKRLTAHCGGAQIYLKREDLNHTGAHKINHCLGEVLLAKKLGKTKV
IAETGAGQHGVALATAAALMGVACEIHMGVVDIKKEHPNVSRMKILGANLVPVSQGAGTL
KEAVDSAFEAYLGDIKNSMFAIGSVVGPAPYPEMVGYFQSVIGHEAREQFLQATGSLPNK
VVACVGGGSNAMGLFSGFMEDDVVEKIGVEPAGEGLDTPNHAATMTKGVKGEIQGFKCYV
LLNDKGEPAQVHSIASGLDYPGVGPQHSYLRDANLATYEAITDKECLEAFMALSRLEGII
PALESSHAVAYAMKIAKDMPADQSILVNLSGRGDKDIDFVLQKIKV
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgacacagataaaagacagctatggtttacacgcatcgacactaccagacacccaaggc
ctatatggcgagtttgggggaaaaattagtcatcctgaactggcacgagcgctagatgag
ctagagactggatttcgtgaaattattaaaaatgatgactttatcgccgagatgaagcgc
ctgcgtgagacctatgtaggcagacctagcccgatttatcatgctaagcgactgacagcg
cactgcggcggggcgcaaatttatctaaagcgtgaggacttaaaccataccggcgcccac
aaaatcaaccactgcttaggtgaggtgctactggccaaaaaactgggaaaaaccaaggta
atcgctgagaccggtgcaggccagcatggggtagcattggcgacggcggcagcacttatg
ggcgtggcctgcgagattcatatgggggtggtcgatatcaaaaaagagcatcctaatgtc
agccgtatgaaaatcttgggcgccaatctggtgcccgtatcacaaggcgctggtacctta
aaagaggcggttgatagtgcttttgaggcgtatttgggtgatattaaaaacagtatgttt
gccattggctcagtggttggtcccgcgccttatcctgagatggtcgggtactttcaatcg
gttattggccatgaagcgcgcgagcagttcttacaggcgactggtagtttacctaataaa
gtcgtggcttgtgtcggtggcggctccaacgccatgggtctattcagcggctttatggaa
gatgatgtcgttgagaagattggtgttgagccggcaggcgaggggttagatacgccgaat
catgcggccaccatgactaaaggtgtcaaaggtgagatacaaggctttaagtgttatgtg
ctacttaatgacaaaggcgagccggcacaagtgcattctatcgcttcagggctagactat
ccgggcgttggtcctcagcactcttatttgcgcgatgccaatttggccacttatgaagca
atcacagataaagaatgtttagaggcgttcatggccctgtctcgcctggagggtattatc
ccagcactggagtcctcacatgcggtggcttatgcaatgaagattgccaaagacatgccg
gctgatcagagcatcttggtcaacttgtccggtcgaggtgataaagacattgactttgta
ttacagaaaattaaggtatag

DBGET integrated database retrieval system