KEGG   Psychrobacter sp. PRwf-1: PsycPRwf_1648Help
Entry
PsycPRwf_1648     CDS       T00541                                 

Gene name
trpC
Definition
Indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
prw  Psychrobacter sp. PRwf-1
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:prw01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:prw00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2037011..2037856
Genome map
AA seq 281 aa AA seqDB search
MTHDAIPSILKKIVLTKESEVASAKAQQALPAIRAEAEQLAASQEAPRRGFAQALLAKQS
AGVPGIIAEVKKASPSKGIISPNFDPSRVAKQYEQAGAVCLSVLTDEQYFQGHNSYLQQA
KAACSLPVLRKDFMIDEYQIYQSYLLGADCILLIVACLDDKQLHHLHELACKLSMDVLIE
VHTLHELERALKLPASEHNIYGINNRDLNTFNTDLQTSIKLKEFLDNQSAKPQLLVTESG
IHSTEDMQLMLTHHINCFLIGEQFMKTEHPGDTLAALLSSL
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgacgcatgatgccatcccctcaatcctaaaaaaaattgtgctgaccaaagagtctgaa
gtggccagtgccaaagcacaacaagcgctgcctgcgattagagctgaggctgagcagctt
gctgcctctcaagaggcccctcgccgcggttttgcccaagcgttattggccaaacaaagc
gctggcgtgccaggcatcattgctgaggtcaaaaaggcgtcaccatcaaaggggattatc
tcacctaactttgatcctagccgagtcgctaagcaatatgagcaagctggtgctgtctgt
ctgtctgtactgactgatgagcagtattttcaaggccataacagctacttacaacaggcc
aaagccgcttgtagcttacccgtacttcgcaaagactttatgattgatgagtatcagatt
tatcagtcctacctactgggcgctgactgtattttgttaattgttgcctgcttagatgac
aagcaattacatcatctacatgagttggcctgcaaacttagcatggatgtccttatcgaa
gtgcatacccttcatgagctagagcgcgccctaaagctaccggcgtctgagcacaatatt
tatggcataaataaccgcgatttaaacacctttaatactgacctacaaacctccataaaa
ctcaaagaattccttgataatcagtcagccaaacctcagctgttggtgaccgaaagtggc
attcatagcactgaggatatgcagctaatgctcactcatcacataaactgctttttaatt
ggcgagcagtttatgaaaactgagcatccgggcgacaccctagccgccctactcagctca
ctgtaa

DBGET integrated database retrieval system