KEGG   Psychrobacter sp. PRwf-1: PsycPRwf_1654Help
Entry
PsycPRwf_1654     CDS       T00541                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
prw  Psychrobacter sp. PRwf-1
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:prw00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    PsycPRwf_1654
Enzymes [BR:prw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     PsycPRwf_1654
Exosome [BR:prw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PsycPRwf_1654
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2044902..2046491)
Genome map
AA seq 529 aa AA seqDB search
MAGYILALDQGTTSSRAIIYDDQARPIKISQKPTTLLTPKLGYVEQDAMQIWHTQISCAH
DAINQAGLLATDISSLAITNQRETIVIWDKRTGNPLAPAIVWQDRRSDAWCQQMQQQRVA
KQDMTMQQYVQSITGLRLDPYFSASKIIWMLDNHPNLKDRAQRGEVAVGTIDSWLMFKLT
GGEHVIDITNASRTLMYDINKLEWSNELLSKFGINKNILPKVLPSDGDFGKTKKGLFAKQ
IPIQAVLGDQQAALFGQGCISTGMAKNTYGTGCFMLMNIGSEVQLSQHQLLTTVGWQRRV
DTAALRTNQMEHPSLSKLVKSGQRILTPAKREVTYALEGGVFMAGAIVQWLRDNLGLFNK
SEDVERLAKEVASSEEVVLVPAFTGLGAPYWRSDITASISGMSRGTTKAHIARAALESIA
FQTYDVLSAMQKDSPSPLTELRVDGGAANNNLLMQFQSDMLGVPVLRPKDTEITAKGVAL
LAGITAGLYDETTIDDSWDLDHSFEPMMSADEREAHLDKWHKAITKTLQ
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atggcaggttacattttagcattggatcaaggtaccacctcgagtcgtgccattatatat
gatgaccaggcgcggcccattaagatatcacaaaagccgaccaccctgcttaccccaaag
cttgggtatgtcgagcaagatgctatgcaaatttggcacactcagattagctgtgctcat
gatgccatcaaccaagccggcttactggcgacagacatcagcagtttggcgattaccaat
cagcgcgaaaccatcgtgatctgggacaagcgtaccggcaatccattggccccagccatt
gtttggcaagacaggcgctctgatgcttggtgtcagcagatgcagcagcagcgtgtagct
aagcaggatatgaccatgcagcagtacgtgcagtcaatcaccggcctgcgtctcgatcct
tattttagcgccagtaaaattatatggatgcttgataatcaccccaatctaaaagataga
gcacagcgcggtgaagtggctgttggcaccatcgacagttggcttatgtttaaattaacg
ggtggtgagcatgtgatagatattaccaacgcctctcgcaccttgatgtacgatatcaat
aagcttgagtggtccaatgagctgctctccaaatttggtattaacaaaaacatcttaccc
aaagtgctgccctcagatggtgactttggcaagacaaaaaaaggactgtttgccaagcaa
atcccaattcaagctgtcttgggagatcagcaggcagcgctgtttggtcaaggctgtatc
tcaacaggtatggccaaaaatacttatggtaccggctgctttatgctaatgaatattggt
agtgaggtgcagctgagccagcatcagttgttgaccacagtgggctggcagcgccgagtc
gatactgccgcgctgcgtaccaatcaaatggagcatccttcattatctaagctggttaag
tccggtcagcgtatcttaacccctgccaagcgtgaggtaacttatgcgctagagggcggg
gtatttatggctggtgccattgtgcagtggctgcgcgacaacttaggtttatttaacaag
tcagaagatgttgagcggttggcaaaagaggttgcgagcagcgaagaggtggtcttagtg
cctgctttcaccggccttggcgccccttattggcgatcagatattaccgccagtatctca
gggatgagccgtggtaccactaaggcacatattgcccgagctgctttagaatccattgct
tttcaaacgtatgacgtgcttagtgccatgcaaaaagacagccccagtccattgactgag
ttaagggtagatggcggtgctgctaataataatttgttgatgcagtttcagtcagatatg
cttggggtgccagtattacggcccaaagatactgagattaccgctaaaggggtggcgctg
ctggcaggtattacagccggtctttatgatgagaccaccattgatgactcttgggactta
gaccatagctttgagccgatgatgtctgctgatgagcgtgaggcgcatctggataaatgg
cataaagcaattaccaagactctacaataa

DBGET integrated database retrieval system