KEGG   Psychrobacter sp. PRwf-1: PsycPRwf_1672Help
Entry
PsycPRwf_1672     CDS       T00541                                 

Definition
malate synthase G
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
prw  Psychrobacter sp. PRwf-1
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:prw01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:prw00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:prw00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2068951..2071155)
Genome map
AA seq 734 aa AA seqDB search
MSNSVNNNQNRVQKGILAIDSELYNFIENDVLPRVGVDSQAYWSNFEKIVKQFTPRNKEL
LAKRDELQAKIDQWHLDNPAKDGEIDYPKYKEFLTDIGYLLPEGDDFEVSTENVDAEIAT
IPGPQLVVPVRNARYALNAANARWGSFYDALYGTDVIDTADGKDKGSSYNPKRGAEVVAY
AKAFLDDNFALSEGSYTDVTGFSVEDGKLNIAQGDSTTSLANSAQFAGYVGEASSPTGIL
LKNNNLHVEIQIDASHPVGQDDPAHIKDVLLESAITAIQDCEDSVAAVDAEEKVEAYRNW
FGLMNGDLTEKFMKGGKELTRQLNPDREYTTPEGGKLVLPGRAVLLIRNVGHLMQNPAIL
VDLGEGQEEIFEGMMDALITPLLTINDIKGKSTRSNSREGSMYIVKPKMHGPEEVKFAND
LFAAVEDALNLPRNTLKMGVMDEERRTTVNLKESIRQAKERVIFINTGFLDRTGDEIHTS
MNAGPFVRKGDMKSQAWQPAYEQWNVDIGIETGLIGRAQIGKGMWAKPDEMKEMVETKMN
HPQAGATTAWVPSPTGATLHSIHYHQNNVQQIQEGFKGRERASLDDILTIPLAKDTNWTD
EEKRQELENNAQGILGYVVRWVDQGVGCSKVPDINNVGLMEDRATLRISSQHIANWLHHG
IVTEEQVMDAMKRMAKVVDEQNLGDASYMPMADNFDHSIAFKAACDLVFKGRAQPSGYTE
PLLHAARLKLKANG
NT seq 2205 nt NT seq  +upstreamnt  +downstreamnt
atgagtaactctgttaataacaaccagaaccgtgttcaaaaaggcattcttgccattgat
agcgaactttataattttattgaaaatgatgtgttaccccgcgttggtgtggactcacaa
gcttattggtcaaatttcgaaaaaatcgtaaagcagtttaccccgcgtaataaagagcta
ttggccaagcgtgatgagctacaagccaaaattgatcagtggcatttagacaatcctgcc
aaagacggggagattgactatccaaaatataaagagtttttgaccgacattggctactta
ttgccagaaggcgatgactttgaagtatctaccgaaaatgtcgatgccgaaatcgcaact
attcctggtccacagctggtggtgccggttcgtaatgctcgttatgcattgaatgcggcc
aacgcacgttggggcagcttttatgatgccttgtatggcacagatgtgattgatactgcc
gatggcaaagacaagggtagcagctacaatccaaagcgtggggcagaagtcgtggcctat
gccaaagccttcttagatgacaactttgccttatctgaaggcagctataccgatgtgact
ggctttagcgttgaagatggcaagttaaacatcgctcaaggcgacagcacaacctctttg
gccaacagcgctcagttcgcaggctatgtgggtgaggcatcaagccctaccggcatctta
ttaaagaacaataacttacacgttgagattcagattgatgccagccatccagtaggtcaa
gatgacccagcgcacataaaagatgtgttattagaatcggcaatcaccgccattcaagac
tgtgaagactcagtagccgctgtagatgcggaagagaaagtagaagcttatcgtaactgg
tttggtctgatgaatggtgacttgactgagaagtttatgaagggtggcaaagagctgacc
cgtcaactcaacccagatcgtgaatacactacacctgagggcggcaagctggtactacct
ggacgtgcggtattgttaatccgtaacgtgggtcacttaatgcaaaacccagctatcttg
gtagacttaggtgagggtcaagaagagatcttcgagggtatgatggatgcgcttatcacg
ccactattgaccatcaacgatattaaaggcaagagtacacgctcaaactctcgtgaaggc
tctatgtatattgtaaaaccgaaaatgcatggccctgaagaagtgaaatttgccaatgac
ctatttgctgcagtagaagatgcccttaatctgcctcgcaataccctaaaaatgggggtt
atggatgaagagcgccgcaccacagtcaacctaaaagaaagtatccgccaagctaaagag
cgcgttatctttattaatactggcttcttagaccgtacaggcgatgagattcataccagt
atgaatgcaggtccctttgtacgcaaaggggatatgaagtcgcaagcttggcagcctgcc
tacgagcagtggaacgtggatattggcattgagaccggcttaattggccgcgctcagatt
ggtaaaggcatgtgggctaagcctgatgagatgaaagagatggttgagactaagatgaac
catccacaagctggtgccacgactgcttgggtaccttcgcccacaggtgctactttacat
agcatccattatcatcaaaacaatgtacaacagattcaagagggctttaaggggcgtgag
cgtgccagcttagatgatatcttaaccattccattggccaaagacaccaactggacagat
gaagagaagcgtcaagagcttgagaacaatgctcaaggcatactaggttacgtagtacgc
tgggtagatcaaggcgtgggctgttcaaaagtgccagacatcaataacgtaggcctaatg
gaagaccgtgctaccttacgtatctcaagtcagcacatcgctaactggttacaccatggt
atcgtaaccgaagagcaggtaatggatgccatgaagcgtatggcaaaagtggtcgatgag
caaaacctaggtgatgcaagctatatgcctatggcggataactttgatcattctattgct
tttaaagccgcctgtgatttggtgttcaaaggacgcgcgcagccaagtggctacactgag
ccattactgcatgcggcgcgcttaaagctaaaagccaatggctaa

DBGET integrated database retrieval system