KEGG   Psychrobacter sp. PRwf-1: PsycPRwf_1728Help
Entry
PsycPRwf_1728     CDS       T00541                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
prw  Psychrobacter sp. PRwf-1
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:prw00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PsycPRwf_1728 (recR)
DNA repair and recombination proteins [BR:prw03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      PsycPRwf_1728 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2137815..2138402)
Genome map
AA seq 195 aa AA seqDB search
MLTEKFDNLVKQLRVLPGVGQKTAQRMALHLLNGRRGQGSALAQALDIAMHEIIECRQCH
SFSDDDICPICVDPRRDDSVLCVVETAADVMAIEQAAGYRGRYFVLGGHLSPLDGINADD
LNIDQLVNRVKTAPVDEIILATSTTVEGQTTAHFIAEAVRRHVGKVTRIAQGIPMGGELE
YLDSMTLSQALQNRS
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
ttgttaaccgaaaaatttgataatttggttaagcagctgcgtgtgctgccaggtgtgggt
caaaagaccgcccaacgtatggcgctgcatctgctaaatggtagaagagggcaaggctca
gctttggcgcaggcgctagatatcgccatgcacgaaatcattgaatgtcgtcaatgccat
tcttttagtgatgatgacatctgtcctatctgcgttgatcctagacgtgatgatagcgtg
ctgtgtgtggtggagaccgccgctgatgtcatggccatcgagcaagcagcaggctataga
ggtcgctattttgtgttgggggggcatttatcgccattagatggtattaatgccgatgac
ctcaatatagatcagctggttaaccgagtcaaaaccgcaccggttgatgaaattatccta
gccaccagtaccaccgtagaggggcagaccaccgcgcattttatcgctgaagctgtgcgt
cgccatgtgggcaaggtcacgcgtatagcacaaggtattcctatgggcggtgagcttgag
tatttagacagtatgaccttatcgcaagcgctacaaaaccgctcttag

DBGET integrated database retrieval system