KEGG   Psychrobacter sp. PRwf-1: PsycPRwf_1827Help
Entry
PsycPRwf_1827     CDS       T00541                                 

Definition
phosphoglucomutase/phosphomannomutase subunit alpha/beta
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
prw  Psychrobacter sp. PRwf-1
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:prw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PsycPRwf_1827
   00030 Pentose phosphate pathway
    PsycPRwf_1827
   00051 Fructose and mannose metabolism
    PsycPRwf_1827
   00052 Galactose metabolism
    PsycPRwf_1827
   00500 Starch and sucrose metabolism
    PsycPRwf_1827
   00520 Amino sugar and nucleotide sugar metabolism
    PsycPRwf_1827
  Nucleotide metabolism
   00230 Purine metabolism
    PsycPRwf_1827
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PsycPRwf_1827
Enzymes [BR:prw01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     PsycPRwf_1827
    5.4.2.8  phosphomannomutase
     PsycPRwf_1827
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2268964..2270574
Genome map
AA seq 536 aa AA seqDB search
MPKTSFLAQRALFKAYDIRGNAALFTPDFVKALGLAFAQDLAETAQARQVVIGYDVRHGS
KSIAEQFVQSLCERGIEVIWLGLVTTPIMAFWANRYQGHGLIVTASHSEGHILGIKWLIS
GESPSYERIQMLYQRLISQQPADASTATSTNPAATPKVIAPNQVGHTYANSAAIALDNIR
KFRSLALVQHSLSQKTPDRLKVVIDSLNGATGPYVAAFFEPHQRLCDIILINKTPDGDFP
KGNPDPMEDKRLTELSQAVIEHQADLGLAFDGDGDRLMVVDNQGHCLAPDHLLYLLARVS
IEDHQPVEACLNAPAPIVLFDVKCTHHMPRLITALGAVPQMSKTGSSILRRTLQTKQDNN
PDHAPILFAGELSGHFLFNDGYFLLHDDAMYAALRLLNWLQYQAQHAKPAQLTDILKTLP
PMVSTPDVYLPLDAYEASPLQQNTPLLNKLMALCDKLSQSIELPKGAQLTCIDGLRLDFA
HGFGIIRPSNTSNSLTVRFAGDSLSDLKSVQGYFVKLCHFINDDLAKQVANIQIKS
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
ttgcccaagacctcatttttagcacagcgagccttatttaaagcttacgatatccgtggt
aatgctgctttatttaccccagattttgttaaagcactgggcctcgcctttgctcaggat
ttagccgaaactgcccaggcgcgccaggtggtcataggctatgatgtgcgtcatggcagc
aaaagtattgccgagcagtttgtgcaaagcttatgcgagcgaggcatcgaggtgatttgg
ctgggacttgtgaccacacctatcatggcgttttgggccaatagataccaaggccatggg
cttattgtcacagccagtcattctgagggtcatatcttgggtattaaatggctaatctca
ggcgagtcgcccagctatgagaggatacaaatgctgtaccagcgcttaatctctcaacag
ccggccgatgctagcacagctacgagcacaaacccagctgctacccccaaagtcattgcg
cccaaccaagtggggcacacttatgccaatagcgcagccatcgcccttgacaacatacgt
aagtttcgcagcttagcgttagtgcagcattcgcttagccaaaaaacgcctgaccgcctt
aaggtggttatcgatagcttaaatggtgccactggcccctatgtcgccgctttttttgag
ccacatcagaggttgtgcgatattattttaatcaataaaaccccagatggggacttccct
aagggcaaccctgatcctatggaggataagcgccttaccgaattaagtcaggcggtgatt
gaacatcaagctgacttaggtttggcttttgatggtgatggggatcggctgatggtggtg
gacaatcaaggtcactgcttggcgccagaccatctgttatatctgttggcgcgcgtctct
atcgaagaccaccaacctgttgaagcctgcctaaatgcacctgcacctatcgtactgttt
gatgttaaatgtacccatcacatgccgcgacttatcacagcactaggagctgtgccgcaa
atgagtaagaccggcagtagtatcttgcgccgtacgcttcagaccaaacaagacaacaat
cctgaccacgcacccatcttatttgccggtgaattgtcgggacattttttattcaatgac
ggctattttttattacatgatgatgccatgtatgcagcgctgcgcctacttaattggcta
caatatcaagcgcaacacgccaagccagctcagttaactgatattcttaaaactctgccg
cccatggtcagcaccccagatgtgtatttgcctcttgatgcctatgaagcgtcaccgcta
cagcaaaatacgcccttattaaataagctgatggctctttgcgataagctcagccaaagc
attgagctgcctaaaggtgcgcagttgacctgtattgatggcttgcgtctagattttgcg
catggatttgggatcattagaccctccaataccagtaacagcttaaccgtacgcttcgca
ggcgactccctatctgatttaaaaagcgtgcaaggctactttgttaaattgtgtcacttt
attaatgatgatttggccaagcaggtagccaacattcagataaagtcctaa

DBGET integrated database retrieval system