KEGG   Psychrobacter sp. PRwf-1: PsycPRwf_1856Help
Entry
PsycPRwf_1856     CDS       T00541                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
prw  Psychrobacter sp. PRwf-1
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:prw00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:prw00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2309232..2310320)
Genome map
AA seq 362 aa AA seqDB search
MPKTAMTDSTSKTSTNTASSDMAAEFDSTTARLNASLSKPQLNADGHLRHFLGIEGLSRA
QLLAIIHKAESFFDDKGQLINSPELEGCTVMNLFFEPSTRTRTTFEVAEKRLGANVLNID
IARSSTQKGESLRDTLWNLQAMTADIFVVRHSASGAAHFMATEVTPDIAIINGGDGWHAH
PTQAMLDMLTIHREAPRPFEELTVAIIGDIKHSRVARSDIAALKILGVKEIRVIAPRTLL
PKGIERYGVKVFENIDEGVVDCDVLMGLRIQNERIGSPLMAASNEYFKKYGITPERVAKA
KPDALVMHPGPMNRGVEIASSVADGPQSVILKQVNNGIAVRMAVLSMAMQGQREYQALRS
ST
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgcctaaaactgccatgactgattctacctccaagacaagcactaataccgcaagctct
gatatggctgctgaatttgactcaaccacagcgcgtttaaatgcctcgttgagtaagccg
cagcttaatgctgatggtcacttgcgtcattttttgggcattgaaggcctaagccgcgca
cagttgctggcgattattcataaggccgagagtttctttgatgacaagggacagctgatt
aacagcccagagcttgaaggctgtacggtgatgaacttgttttttgagccatcaacccgc
actcgcaccacctttgaggtggccgaaaagcgtttgggcgcgaatgtattgaacatagat
attgcccgttcaagcacccaaaagggagagagtctgcgcgatacgttatggaacttgcaa
gcaatgaccgctgatatcttcgtggtacgccattcagcttcaggtgcagcacattttatg
gcgacagaggtaacccccgatattgccattatcaatggcggtgatgggtggcatgcccat
cccactcaagccatgctagatatgctaaccattcaccgtgaagcaccacgtccttttgaa
gagttgacggtggccattatcggcgatattaagcactctcgtgtggcacgctctgatatt
gccgctctaaaaatactaggtgtcaaagagattcgagtcatcgcccctcgtaccttactg
cctaaaggtattgagcgttatggggtaaaagtatttgaaaacatcgatgagggggtggtg
gactgtgatgtgctgatgggtctgcgcattcaaaatgagcgtattggttcgccgcttatg
gccgcttcaaatgagtattttaaaaaatatggcattaccccagagcgtgtggccaaagcc
aaacccgatgccttggtcatgcacccaggccctatgaaccgtggggttgagattgcctct
agcgtggcagacggtccacagtcggtgattttaaagcaagtaaataatggtattgcggtt
cgtatggcagtgttgtcgatggcaatgcaaggtcagcgtgaatatcaagccctacgctca
agcacctag

DBGET integrated database retrieval system