KEGG   Psychrobacter sp. PRwf-1: PsycPRwf_2009Help
Entry
PsycPRwf_2009     CDS       T00541                                 

Definition
protein-disulfide isomerase-like protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
prw  Psychrobacter sp. PRwf-1
Brite
Enzymes [BR:prw01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     PsycPRwf_2009
Secretion system [BR:prw02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   PsycPRwf_2009
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2500877..2501710
Genome map
AA seq 277 aa AA seqDB search
MTPLFHQNLLKKSPAFTKASLMALAIAVAGCNSNSTEARNEPSKTPTSAKQNTSASSDSD
PKVVAALEANFKASGFEQKIISAIPTSMDNIYWVTAEGMPAFFSDKEGRHIIQGQIVEIG
QAHPVDISADLIAQSAKQKLAAVDKKEMIIYPAKGATKAVVYVFTDADCPYCTKLHSEMS
DINAQGIEVRYLAWPRSDASIPKMEAIWCSSDRMQAMDDAKAGKPLSSPKCDSPVRSHIE
LGMSLGVSGTPAIFTESGHQIGGYLPAKELAAAALAH
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgacccctttatttcaccaaaacttattaaaaaaatcacccgctttcaccaaagcgtca
ttgatggcattggccatcgccgtcgctggctgtaacagcaacagcactgaagctagaaac
gagccgagcaagacgcccacgagcgccaagcaaaataccagtgccagttctgactctgat
ccgaaggtagtggccgcgttagaagccaactttaaggcctcaggttttgagcaaaaaatc
atctcggccatccccacctcaatggacaatatttattgggtgactgccgagggcatgccc
gccttttttagtgataaagaaggtaggcacatcattcaaggacagattgtcgagattggt
caagcgcatccggttgatatcagtgccgacttgatagcacagagcgccaagcaaaaactg
gcagccgtggataaaaaagagatgattatttatccggccaaaggcgccaccaaagctgtg
gtctatgtctttaccgatgccgactgcccttattgcaccaaattgcattctgaaatgagt
gatatcaatgcccaagggatagaggtgcgttatcttgcttggccacgcagtgatgccagt
attccaaaaatggaagccatctggtgtagcagtgaccgtatgcaggccatggacgacgcc
aaagccggtaagccattatcctcgcctaagtgtgatagccctgttcgttcacacattgag
ctgggtatgagcttaggcgtgagtggcacacctgctatctttaccgaatctggtcatcaa
attggcggctatttgcctgccaaagagctggccgccgccgcccttgctcactaa

DBGET integrated database retrieval system