KEGG   Psychrobacter sp. PRwf-1: PsycPRwf_2066Help
Entry
PsycPRwf_2066     CDS       T00541                                 

Definition
enoyl-CoA hydratase/isomerase
Orthology
K13766  
methylglutaconyl-CoA hydratase [EC:4.2.1.18]
Organism
prw  Psychrobacter sp. PRwf-1
Pathway
Valine, leucine and isoleucine degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:prw00001]
 Metabolism
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PsycPRwf_2066
Enzymes [BR:prw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.18  methylglutaconyl-CoA hydratase
     PsycPRwf_2066
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2576110..2576931)
Genome map
AA seq 273 aa AA seqDB search
MTTSLPSQLAPLAELDTLNVDVADYIATVTLARPDKRNAFNDDVIEELNQAFTQLGNSDA
VRVIVLAAEGKAFCAGADLNWMRAMADYSRDENLADADKLAQMLKVIYTCPKPTVAAIQG
DVYAGGIGLVSACDVAIAVDSANFCLSEVRLGLVPATISPYVIRAMGARAAHRYFLTAEV
FDAIEAQRIGLVHEAVAADKLDETVAAITKKLRNNSPNAVKECKNLLHYVAGETIDEALI
AQTVAGIADIRASDEGKEGVQSFLQKRKPNWLN
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgacaaccagcttaccctctcaattagcaccgttagctgagcttgataccttaaacgtc
gatgttgcagattatattgctaccgtcactctggcgcgcccagacaagcgtaatgccttt
aatgatgacgtcattgaagaattaaaccaagcgtttacccagctaggcaatagcgatgca
gtgcgagttattgtgttagcagccgaaggtaaggcattttgcgcaggcgccgatttaaac
tggatgcgtgccatggctgattatagccgtgatgagaatcttgcagatgccgataaactg
gcacaaatgctcaaggtgatttacacctgtcctaagccaaccgttgccgccattcaaggc
gacgtttatgctggtggtattggtcttgtctctgcctgtgatgttgccatagccgtcgac
tcagccaacttttgtcttagtgaggtgcgtctaggattggtgccagctaccattagccct
tatgtgattagagcgatgggtgctcgagcggcacaccgatattttttgaccgctgaagta
tttgatgcgattgaagcacagcggattggattggttcatgaggcggtcgctgctgataaa
ctggatgagacagtcgctgctattaccaaaaagctgcgtaacaacagcccaaatgcggtg
aaagagtgtaaaaatctgctgcactatgtcgccggagaaaccattgatgaggctttaatt
gcccagaccgtagctggtattgcagatatcagagcctctgatgaaggtaaagaaggggtg
caatccttcttgcaaaaacgcaaacctaattggttaaattaa

DBGET integrated database retrieval system