KEGG   Psychrobacter sp. PRwf-1: PsycPRwf_2100Help
Entry
PsycPRwf_2100     CDS       T00541                                 

Definition
(GenBank) short chain enoyl-CoA hydratase / 3-hydroxyacyl-CoA dehydrogenase
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
prw  Psychrobacter sp. PRwf-1
Pathway
prw00071  Fatty acid degradation
prw00280  Valine, leucine and isoleucine degradation
prw00281  Geraniol degradation
prw00310  Lysine degradation
prw00362  Benzoate degradation
prw00380  Tryptophan metabolism
prw00410  beta-Alanine metabolism
prw00640  Propanoate metabolism
prw00650  Butanoate metabolism
prw00903  Limonene and pinene degradation
prw00930  Caprolactam degradation
prw01040  Biosynthesis of unsaturated fatty acids
prw01100  Metabolic pathways
prw01110  Biosynthesis of secondary metabolites
prw01120  Microbial metabolism in diverse environments
prw01130  Biosynthesis of antibiotics
prw01200  Carbon metabolism
prw01212  Fatty acid metabolism
Module
prw_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:prw00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PsycPRwf_2100
   00650 Butanoate metabolism
    PsycPRwf_2100
  Lipid metabolism
   00071 Fatty acid degradation
    PsycPRwf_2100
   01040 Biosynthesis of unsaturated fatty acids
    PsycPRwf_2100
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PsycPRwf_2100
   00310 Lysine degradation
    PsycPRwf_2100
   00380 Tryptophan metabolism
    PsycPRwf_2100
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PsycPRwf_2100
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PsycPRwf_2100
   00281 Geraniol degradation
    PsycPRwf_2100
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PsycPRwf_2100
   00930 Caprolactam degradation
    PsycPRwf_2100
Enzymes [BR:prw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     PsycPRwf_2100
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     PsycPRwf_2100
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     PsycPRwf_2100
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     PsycPRwf_2100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: ABQ95040
JGI: PsycPRwf2100
UniProt: A5WH99
Position
complement(2619268..2621427)
Genome map
AA seq 719 aa AA seqDB search
MIYQGNRITVSLLDDGIANMQFNAEGESVNKFDAETNKQFDEAVSALEKADNVKGLIVTS
SKGVFIAGADITEFVSHFNKEAAEIEKWIVDINGVFNRFEDLPFPKVAAINGAALGGGCE
MTLVCEYRVMGDKAQIGLPETQLGIFPGFGGSVRTPRVIGIDNAVELIATGKAQKPAEAL
KLGLVDAVVAQDDLQEAAVDLVKKCIAGDLDWQAKREEKLQPVKLNQLEQTMAFSTAKAA
IFAKANPKQYPAPAIAIETIEKHVNLGRDEAIKVEAAGFAKAAKTPQAESLVGLFLNDQT
VKKLAKQHTKNAHDINEAAVLGAGIMGGGIAYQAASKGLPIIMKDIKSEQLDLGMGEASK
LLGKMVERKKMTPAQMGETLSRIRPTLNYGDFGETDIVIEAVVENPKVKHAVLKEVEGLV
KDNAILASNTSTISITYLATVLERPENFVGMHFFNPVHRMPLVEVIRGEKSSEEAIATTV
ALAQRMGKVPVVVNDCPGFLVNRVLFPYFGAFDLLLKQGADFVHVDKVMEKFGWPMGPAY
LIDVVGLDTGVHGAEVMAEGFPDRMKPDYKGAIKHLFENNRLGQKNGVGFYKYEKDSRGK
PKKTADDATYALLKDTTDTDNQQFDDQTIIDRMMLAFCNETVRCLEDNIVATPSEADMAM
IMGVGFPAFRGGPCRYIDQVGLDNYLALCEKYAHLGKAYEAPQKIRDMAAAGETFYPKA
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atgatatatcaaggtaaccgcattacggtatcgctgttagacgacggtattgctaacatg
caatttaacgccgagggtgagagtgttaataagtttgatgccgaaacaaataagcagttc
gatgaagctgtgagtgccttagaaaaagcagataatgtaaaaggtttaattgttacctca
agtaaaggcgtctttatcgcgggtgctgacatcactgagttcgtgagtcattttaataaa
gaagcagctgagattgaaaagtggatcgttgacatcaacggtgtatttaaccgttttgaa
gacctgccattcccgaaagttgcggccattaatggcgcagcattgggcggcggctgtgaa
atgactttggtttgtgaataccgtgtgatgggcgacaaagcacaaatcggtctaccagag
actcaattaggtatcttcccaggctttggtggtagcgtacgcacgcctcgtgttatcggt
atcgataatgcagtagagctgattgcaaccggtaaagcacaaaaacctgctgaagcgttg
aagctgggtctagtagatgctgtggtagcacaagatgacttacaagaagcggccgtggat
ctggtcaaaaaatgtatcgcaggcgatcttgattggcaggccaaacgtgaggagaagctt
cagccggttaaactaaaccagcttgagcagactatggcatttagcactgctaaagcggcc
atctttgccaaagccaatccaaaacagtacccagcgcccgccattgcgatcgaaaccatc
gaaaagcatgtcaatctaggccgtgatgaagcgattaaagtagaagcagccggttttgcc
aaagcggcgaagaccccacaagcagaaagcttagtgggtctgttcttaaatgatcaaacg
gttaagaagcttgccaaacagcacaccaaaaatgcacatgatatcaatgaagcggcggta
cttggcgctggtatcatgggtggcggtattgcctatcaagcggcttcaaaaggcttgcca
attatcatgaaagacatcaagtctgagcaattagacttaggtatgggtgaagccagcaag
ctattaggtaaaatggttgagcgtaagaaaatgaccccagcacaaatgggtgaaacgcta
agccgtatccgtcctactttgaattacggcgactttggcgagactgacatcgtgatcgaa
gcggttgttgaaaatccaaaagtaaaacacgcggtattaaaagaagtagaaggcttagta
aaagacaacgccattcttgcctctaatacctcaaccatctcaatcacctacttagccact
gtgcttgagcgcccagagaacttcgtgggtatgcacttctttaacccagtacaccgcatg
ccgctagtggaagttatccgtggtgaaaaatcatcagaagaagccattgcaaccacggtt
gcgttagctcagcgtatgggcaaagtacctgttgtggtcaatgactgcccaggtttctta
gtcaaccgcgtattgttcccatacttcggtgcgtttgacctgctattaaaacaaggcgct
gactttgttcatgttgataaagttatggagaaattcggctggcctatgggtcctgcctat
ttaatcgacgtggtgggtctagacactggcgtacacggcgcagaagtgatggcagaaggc
ttcccagatcgcatgaagccagattacaaaggcgctatcaagcatctgtttgaaaacaac
cgtctgggtcagaaaaacggcgttggcttctataaatacgaaaaagacagccgtggtaag
cctaagaaaacagcagacgacgccacttatgcactgcttaaagacaccactgatacagat
aatcagcagttcgatgatcaaaccatcatcgatcgtatgatgctggccttctgtaacgaa
accgtgcgctgcttagaggacaacattgttgcgacgccaagcgaagcggacatggcgatg
attatgggtgtgggcttccctgcattccgtggtggtccatgccgttacatcgaccaagtt
ggccttgataactacttagcgctatgtgagaaatatgcacacctaggcaaagcgtatgaa
gcgccgcagaaaatccgtgatatggcagcggctggcgagacattttacccaaaagcctaa

DBGET integrated database retrieval system