KEGG   Psychrobacter sp. PRwf-1: PsycPRwf_2104Help
Entry
PsycPRwf_2104     CDS       T00541                                 

Gene name
ipk
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
prw  Psychrobacter sp. PRwf-1
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:prw00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PsycPRwf_2104 (ipk)
Enzymes [BR:prw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     PsycPRwf_2104 (ipk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2626207..2627178
Genome map
AA seq 323 aa AA seqDB search
MTSYAKLSLFSPAKINLFLHITGKRADGYHNLQTVFRLLDWGDTLEFLVTQDSFDPTAPI
NEQHLLVRLSSTVAITAQVMDNLVIKAAVALLQAWQNSALTRSSDPAVTPHLPVIEVTLN
KVLPTGAGLGGGSSNAATTLIALNKLWGFHYDIEALIKIGATVGADVPIFVLGQDAIAEG
IGERLTPIKLPQHQYLLLNPAAHAATQALFAHPDLQRNVPALSIDEIKAAQSCYLQQLNA
PFSNVFEPVVTKLVPEVNQALNYLRQLEALTGTQARMTGTGSSVFLPIPTDKISLITHHL
SNAGAPCDYVLTQSLDKNGQNPE
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgacctcgtatgccaagcttagtttattttcaccggcgaaaatcaatctgtttttgcac
attaccggtaaaagagcagatggctatcataacttgcagacggtgtttcgtttgctagac
tggggtgataccctagagttcttggtcacccaggatagcttcgatcctacagcgccgatt
aatgagcagcacttactggttcgcttaagtagcacagtggccatcaccgcacaggtgatg
gacaacttggtcatcaaagcggctgtggcgctgctacaggcatggcaaaacagtgccctc
acacggtcatctgaccccgcggtaacccctcacctgccggttatcgaagtgacgctcaac
aaagttctaccaactggcgcaggccttggtggcggctcctcaaatgcagccactacctta
atagcgctaaataagctatggggctttcattatgacattgaggctttaatcaagattggc
gcaacggtcggcgctgatgtgccaatttttgtgcttgggcaagatgccattgctgagggc
atcggcgagcggctaacccccatcaagttgccacagcatcaatatttgctattaaatcct
gcagctcatgcagcaacccaagccctatttgcccaccctgacttgcagcgcaatgtgccc
gcattaagcatagatgagataaaagcggcacaatcttgctacttgcagcagcttaatgcg
ccatttagcaatgtatttgagccggtggtgaccaagttggtgcctgaggtgaatcaggca
ctcaattatcttagacagcttgaggcgctcaccggcacccaagcacgtatgaccggtacc
ggcagcagtgtatttttgccgatacctactgacaaaatcagcctcataacacatcacctt
agcaatgctggggcgccttgtgattatgtactgacccaaagtttagataaaaacgggcaa
aaccctgaataa

DBGET integrated database retrieval system