KEGG   Psychrobacter sp. PRwf-1: PsycPRwf_2262Help
Entry
PsycPRwf_2262     CDS       T00541                                 

Definition
uroporphyrinogen-III synthase-like protein
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
prw  Psychrobacter sp. PRwf-1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:prw00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PsycPRwf_2262
Enzymes [BR:prw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     PsycPRwf_2262
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2824290..2825159)
Genome map
AA seq 289 aa AA seqDB search
MIFINTRPIERAQPLTQAMQDKGLTVLELPLLELTAIEIGQREQQYQQHFYQQPDQYQAL
VVVSPTAARMGLAACPIGFVPRCAVIAVGHATAEVLRVAGWQVHCPVEYSNEGMMLMPQL
NRLGVGNRILVWRGRGGRRVLVNFLQENGVGVDAIAWYQRQCPPQAEHDFKQLLPQLGLS
EVAKLPDAINLNSLHISPLDNPDANSKHKPLVLISSGEAFTNWRLLMASIDEISDKAVPN
YQLNDFNYLTFGKRLTDTLNQLQLNCVRIENLDTSEVWRGVSALYSDLS
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgatttttatcaatacccgtcccatcgaacgtgcgcagccattaacgcaggccatgcaa
gataaagggttgacggtactagaactgccgctgcttgagttgacagcgattgagattggc
caaagagagcagcaatatcaacagcatttttatcagcagcctgatcaatatcaggctttg
gtagtggtcagtcccactgcggctcgtatgggactggcggcgtgtccgataggctttgtt
cctcgctgtgcggtgattgcggtaggccatgccacagccgaggtgttacgcgttgccggc
tggcaagtgcattgtcctgtagagtacagcaatgaaggtatgatgcttatgcctcagctg
aaccgcttgggggtgggtaatcgtattttggtctggcgaggcagaggtggccgccgagtt
ttggtgaattttttgcaagaaaatggcgtgggtgtcgatgccatcgcttggtatcagcgc
caatgcccaccacaggctgagcatgattttaagcagctgctgccacagctgggtttgtcg
gaagtagcgaagttaccggatgcaattaacttaaatagcttacacatcagcccattagat
aacccagacgctaactctaagcacaagcctttggtactaatcagcagtggtgaagcgttt
accaattggcgcttgctgatggcttcgatagatgagatatcagataaggccgtgcctaac
tatcaattaaatgattttaactatctgacctttggaaagcgcttaacggataccttaaac
cagctacaactaaactgcgtgcgtattgagaatttggatacatctgaggtgtggcgcggg
gttagcgctctgtactctgatttatcttga

DBGET integrated database retrieval system