KEGG   Psychrobacter sp. PRwf-1: PsycPRwf_2332Help
Entry
PsycPRwf_2332     CDS       T00541                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
prw  Psychrobacter sp. PRwf-1
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:prw00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PsycPRwf_2332
   00670 One carbon pool by folate
    PsycPRwf_2332
Enzymes [BR:prw01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     PsycPRwf_2332
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2900030..2900611
Genome map
AA seq 193 aa AA seqDB search
MSYAHTQVAQIVAISRNRCIGKGNDLPWHIPNDLKHFKAMTTAETDAYVDTGLKGIVIMG
RKTFESMGSKPLPKRVNFIVTTQMDYAQQKGLEGLKDVHVVHNLDDALTHAANVAHGLKF
ETIWVIGGERVFKRAMMFTDRIELTVVDTDIEDGDAFYPEIPEDFELTQESESFTDEKSG
LSYKFMTYMVKKG
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgagctacgcccacactcaagttgcccaaattgtggccattagccgcaaccgctgtatc
ggcaagggcaatgatttgccttggcatatccccaatgatttaaaacactttaaggccatg
accaccgctgagaccgatgcttatgtagatacaggcctaaaaggtattgtcattatgggc
cgtaaaacttttgaatcgatgggctcaaagccgctgccaaaacgagtgaacttcattgtc
accactcaaatggactatgcgcagcaaaaagggctagaaggtcttaaagatgtgcatgtg
gtgcataacttggatgatgctttaacccatgcagccaacgtcgctcatggcttaaagttt
gaaactatttgggttatcggcggcgagcgtgtgtttaaacgtgccatgatgttcaccgac
cgcattgagctaacggttgtcgataccgacattgaagacggcgatgcattttacccagag
atacccgaagactttgaactcactcaagaatctgagtcatttactgatgaaaaaagcggc
ctgagctataagtttatgacttatatggtcaaaaagggctaa

DBGET integrated database retrieval system