KEGG   Psychrobacter sp. PRwf-1: PsycPRwf_2332Help
Entry
PsycPRwf_2332     CDS       T00541                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
prw  Psychrobacter sp. PRwf-1
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:prw00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:prw00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2900030..2900611
Genome map
AA seq 193 aa AA seqDB search
MSYAHTQVAQIVAISRNRCIGKGNDLPWHIPNDLKHFKAMTTAETDAYVDTGLKGIVIMG
RKTFESMGSKPLPKRVNFIVTTQMDYAQQKGLEGLKDVHVVHNLDDALTHAANVAHGLKF
ETIWVIGGERVFKRAMMFTDRIELTVVDTDIEDGDAFYPEIPEDFELTQESESFTDEKSG
LSYKFMTYMVKKG
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgagctacgcccacactcaagttgcccaaattgtggccattagccgcaaccgctgtatc
ggcaagggcaatgatttgccttggcatatccccaatgatttaaaacactttaaggccatg
accaccgctgagaccgatgcttatgtagatacaggcctaaaaggtattgtcattatgggc
cgtaaaacttttgaatcgatgggctcaaagccgctgccaaaacgagtgaacttcattgtc
accactcaaatggactatgcgcagcaaaaagggctagaaggtcttaaagatgtgcatgtg
gtgcataacttggatgatgctttaacccatgcagccaacgtcgctcatggcttaaagttt
gaaactatttgggttatcggcggcgagcgtgtgtttaaacgtgccatgatgttcaccgac
cgcattgagctaacggttgtcgataccgacattgaagacggcgatgcattttacccagag
atacccgaagactttgaactcactcaagaatctgagtcatttactgatgaaaaaagcggc
ctgagctataagtttatgacttatatggtcaaaaagggctaa

DBGET integrated database retrieval system