KEGG   Psychrobacter sp. PRwf-1: PsycPRwf_2378Help
Entry
PsycPRwf_2378     CDS       T00541                                 

Definition
cytochrome-c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
prw  Psychrobacter sp. PRwf-1
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2963620..2964774
Genome map
AA seq 384 aa AA seqDB search
MANAHQNNPRKEVTYALVGVIGFLLLVLLIALSGYFRPGGQHVVSNESEDTQDTELGAES
ASNTDVKPLISVRDEPVETITVEAIESPKKVELGKMLWFDTRLSKSGTLSCNSCHDLAKG
GTDNIPTSVGHNWAEGPINSPTVLNSRYFLAQFWDGRAKDLMDQAGGPIENPIEMASSHE
YVEQVLNSIPEYKALFNEAYGSSGDVTIDQVTEAIALFEDTLVTPNSRFDQWLAGDDSAI
NKQELNGYKLFKDSGCIACHNGATLGGSSFQKFGVFEKYTTQNLSEGRYAVTGKEEDRHV
FKVPTLRNIELTYPYFHDGQVDSLAEAVNIMGKIQLNRTYEPQETEDIVAFLKTLTGDQP
QITLPKLPPSNENTPKPIPFKRQG
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atggctaacgctcatcaaaataacccgagaaaggaagtcacttatgctcttgtcggcgtg
attggtttcttactacttgtcttgttaatcgccctttctggatattttcgtccaggcggt
caacacgtcgtatctaatgaatcagaagatacgcaagacacagagctaggcgctgagagc
gccagtaatactgatgtaaagccacttatcagcgttcgtgatgagcctgtcgaaaccatt
acagtagaggcgattgaatcgcccaaaaaagtagagctgggtaaaatgctgtggtttgat
acccgcttatcaaaatcaggaaccttgtcttgtaatagctgtcatgatcttgccaaaggc
ggtacagacaacatcccaacctcagtgggtcataactgggccgaagggccaatcaactcg
ccgacagtgttaaacagtcgctacttcttggcacagttctgggatggacgcgccaaagat
ttgatggatcaggccggtggtccaattgaaaatccaatagagatggcatcgtctcatgag
tatgttgaacaggttttaaactcaatcccagagtacaaagccttgtttaatgaagcttat
ggcagcagtggtgatgtcaccatcgatcaggtaaccgaggcaattgccttatttgaggat
acccttgtgacaccgaattcacgctttgaccaatggcttgccggcgacgatagtgccatc
aataagcaagagctaaacggctacaagctatttaaagacagtggctgtatcgcttgtcac
aatggtgcgacattaggcggcagctcgttccagaagtttggggtctttgagaagtacacc
acacaaaacctatctgaaggacgctacgccgttactggaaaggaagaagacagacacgtc
tttaaagtaccgacactgcgtaacattgagctcacctatccatacttccatgatggccaa
gtagactcattggcagaagcggtcaatattatgggtaaaattcagttaaaccgtacctat
gaacctcaagagaccgaagacattgtggcatttttgaagacgctaactggtgatcagccg
cagattaccctacctaaactgccgccctctaacgagaatacaccaaagcctattccgttt
aaaagacaaggctag

DBGET integrated database retrieval system