KEGG   Psychrobacter sp. PRwf-1: PsycPRwf_2379Help
Entry
PsycPRwf_2379     CDS       T00541                                 

Definition
(GenBank) L-threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
prw  Psychrobacter sp. PRwf-1
Pathway
prw00260  Glycine, serine and threonine metabolism
prw00750  Vitamin B6 metabolism
prw01100  Metabolic pathways
prw01110  Biosynthesis of secondary metabolites
prw01120  Microbial metabolism in diverse environments
prw01230  Biosynthesis of amino acids
Module
prw_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:prw00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PsycPRwf_2379
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PsycPRwf_2379
Enzymes [BR:prw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PsycPRwf_2379
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: ABQ95319
JGI: PsycPRwf2379
UniProt: A5WI28
Position
complement(2964875..2966305)
Genome map
AA seq 476 aa AA seqDB search
MKYISTRGQTEPMDFSDVLLMGLAPDGGLMLPESYPQIDAATLDKWRNLSYPELAFAIMR
LFATDIDEADLKDIIERTYTKEVFGSEDIVPVRKLEDDLYILGLSNGPTLAFKDVAMQFL
GNAFEYVLKQKGKRLTIIGATSGDTGSAAEYALRGKDNIEVFMMSPHGKMSEFQRAQMYS
LTDANIHNIAIKGMFDDCQDIVKALQQDADFKAKYSLGTVNSINWGRILAQIVYYFKAYF
SVTNGAATDSNDEKVSFCVPSGNFGNICAGHIAREMGLPIDRLIVATNENDVLNDFFNQG
TYTPRPADKTYVTSSPSMDISKASNFERFIYLLLDKDSKRVHELFDGVKAGNGFDLSDVL
EAVNSRYGFAAGKSTHQDRLNTIKAVYETYNDLVDPHTADGIKVAQELQKEGEVIICAET
ALPVKFSETIFEAVGEIDIERPEHTKDIESLEQHVTVLDNDASLVADEIKAVVSPV
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatatcagtacgcgtggtcaaaccgagccgatggattttagcgatgtgttgttg
atgggattggcgccagacggcggtttgatgctacctgagagctatccgcagattgatgct
gcgacattggataagtggcgtaatttgagctacccagagctggcgtttgcgattatgcgc
ctgtttgccaccgatattgatgaggcggatttaaaagacattatcgagcgtacgtatacg
aaagaggtctttggtagcgaggacatcgtaccagtacgtaagcttgaagatgacttgtat
attttagggctgtctaatggcccaacgctggcgtttaaagatgtggcgatgcagtttttg
ggtaatgcctttgaatacgtgttaaagcaaaaaggcaagcgtctgaccatcattggtgcg
accagtggcgatacgggcagtgcggcggaatatgcgctacgtggtaaagacaacatcgaa
gtgtttatgatgtcgccacatggcaaaatgagtgagttccagcgtgctcaaatgtatagc
ttaaccgatgccaacattcataacattgccattaaaggcatgtttgatgattgccaagat
atcgttaaagcattgcagcaagatgctgattttaaagccaaatacagcttgggtacggtc
aactcaatcaactgggggcgcatcctagcgcaaatcgtttattactttaaggcgtacttc
tctgtaacaaacggtgcagcaacggatagcaacgatgaaaaagtcagtttctgtgtgcca
tcaggtaactttggtaatatctgtgccggtcacattgcccgtgaaatgggtttgccgatt
gaccgtttgattgtcgcaaccaatgaaaatgacgtattaaatgacttctttaaccaaggc
acttataccccgcggccagccgacaaaacctatgtgacctcaagcccgtcaatggatatc
tcaaaagcgtcaaactttgagcgctttatctatctgttattggacaaagacagcaaacgg
gtgcatgagctgtttgatggagtgaaggcaggtaacggctttgatttgtctgatgtgtta
gaggcagtcaatagccgttatggctttgcggcgggtaaatcaacccatcaagaccgctta
aataccatcaaagcggtgtacgagacttataacgacttggtcgatccacacacagcagat
ggcatcaaagtggcgcaagagctgcaaaaagagggcgaggttatcatctgtgcagagaca
gcattgccagtgaaattttcagagaccatctttgaagcggttggtgagatagacattgag
cgccctgagcataccaaagatattgagagcctagagcagcatgtgacggtactggataat
gatgccagcctagtggcagatgagattaaagcggtggtatcgcctgtttag

DBGET integrated database retrieval system