KEGG   Pseudomonas stutzeri A1501: PST_0190Help
Entry
PST_0190          CDS       T00511                                 

Definition
(GenBank) glutaminase, putative
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
psa  Pseudomonas stutzeri A1501
Pathway
psa00220  Arginine biosynthesis
psa00250  Alanine, aspartate and glutamate metabolism
psa00471  D-Glutamine and D-glutamate metabolism
psa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psa00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PST_0190
   00220 Arginine biosynthesis
    PST_0190
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    PST_0190
Enzymes [BR:psa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     PST_0190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-ProteinID: ABP77897
UniProt: A4VFZ6
Position
222498..223406
Genome map
AA seq 302 aa AA seqDB search
MHALLQEILDEVRPLLGRGRVADYIPALADVPADQLGIAVCSAEGELFEAGDARTPFSIQ
SISKVFSLVQAIGHRGESLWERLGHEPSGQPFNSLVQLEFERGRPRNPFINAGALVICDV
NQSRFATPELSMRDFVRHLSGNPLIVSDTKVAESEYQHRARNAAMAYLMQAFGNFHNDVE
AVLRSYFHHCALRMNCVDLARAFGFLARDGICPQGGEAVLSPRQTKQVNAIMATSGLYDE
AGNFAYRVGLPGKSGVGGGIVAVVPGRFTVCVWSPELNAAGNSLIGMAALEALSQRIGWS
VF
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgcacgccctgctgcaggagattctcgacgaagtacgcccgctgctcgggcgcggccgt
gtggccgactacattccggcgctggccgacgtgccagccgaccaactggggattgccgtg
tgcagcgccgagggcgaattgttcgaggccggcgatgcgcggacgccgttctcgatccag
agcatctccaaggtgttcagcctggtgcaggccatcggccatcggggcgagtcgctgtgg
gagcgcctcggtcacgagccgtccgggcagccgttcaactcgctggtgcagctggaattc
gagcgcggccgcccgcgcaacccgttcatcaacgccggcgcgctggtgatctgcgacgtc
aaccagtcgcgcttcgccactccggagctgtcgatgcgcgacttcgtccggcacctgtcg
ggcaacccgctgatcgtctcggacaccaaggtcgccgagtccgaataccagcatcgcgca
cgcaacgccgccatggcctacctgatgcaggcgttcggcaacttccataacgacgtcgag
gcggtgctgcgcagctactttcatcattgcgcgctgcgcatgaactgcgtcgacctggcc
cgagcgttcggcttcctggcccgcgacggcatctgtccgcagggcggcgaggccgtgctc
tcgccgcgccagaccaagcaggtcaacgccatcatggccaccagcggcctctacgacgag
gccggcaacttcgcctaccgggtcgggctgcccggcaagagcggtgtcggcggcggcatc
gtcgcggtggtgccggggcgcttcaccgtctgcgtctggtcgcccgaactgaacgccgcc
ggcaactcgctgatcggcatggccgcgctggaggcgctgtcgcagcgcattggctggtcc
gtattctga

DBGET integrated database retrieval system