KEGG   Pseudomonas stutzeri A1501: PST_0319Help
Entry
PST_0319          CDS       T00511                                 

Gene name
cysQ
Definition
3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
psa  Pseudomonas stutzeri A1501
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:psa00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
374374..375192
Genome map
AA seq 272 aa AA seqDB search
MSHPYLSAVIDLVRQAGEAILPHWRSELEVQAKADASPVTAADMAAHHVLLDGLQALDGS
IPVLSEEDCAVPLAERAGWTRWWLVDPLDGTKEFIAGSEEFTVNVALIEQGEVRFGVVGI
PASGRCYYGGKDFGAWRSEADGATQPLRVRPHPVGSFTVVASRRHSSPAQERLLDSLRGR
FGELALANVGSSLKFCLLAEGSADCYPRLAPTSQWDTAAAQGVLEGAGGEVLEVAGAPLR
YEARETYLNPSFLALPAGVDWREMLIELANRS
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgagtcatccctacctgtcggcagtgatcgatctggtgcgtcaggctggcgaggcgatc
ctgccgcactggcgcagcgaactggaggtgcaggccaaggccgatgcctcgccggtgacg
gcggcggacatggcggctcatcatgtgctgctggacggcctgcaggcgctggacggcagc
atcccggtgctttccgaagaagattgcgcggtgccgctggccgagcgcgccggctggacg
cgctggtggctggtcgacccgctggacggcaccaaggaattcatcgccggcagcgaggaa
ttcaccgtcaacgtggcgctgatcgagcagggcgaggttcgcttcggtgtggttggcatt
cctgcgtccgggcgctgctattacggcggcaaggatttcggcgcctggcgcagcgaggcc
gatggcgcgacgcagcccttgcgcgtgcggccgcatcccgtcgggagctttaccgtggtg
gccagccggcgccacagcagcccggcgcaggagcggctgctggacagcctgcgcggacgc
tttggtgagctggcgctggccaatgtcggcagctcgctgaagttctgtctgctcgccgag
ggctcggcggactgctatccgcggctggcgccgacctcgcaatgggacacagcggcggca
cagggggtgctggaaggtgccggtggcgaggtgctggaggtggcaggtgcgccgctacgc
tacgaggcgcgggagacgtatctcaatccatcgttcctggcgcttccggccggcgtggac
tggcgcgagatgctgatcgagctggccaaccgcagctga

DBGET integrated database retrieval system