KEGG   Pseudomonas stutzeri A1501: PST_0470Help
Entry
PST_0470          CDS       T00511                                 

Definition
phosphomannomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
psa  Pseudomonas stutzeri A1501
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:psa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PST_0470
   00030 Pentose phosphate pathway
    PST_0470
   00051 Fructose and mannose metabolism
    PST_0470
   00052 Galactose metabolism
    PST_0470
   00500 Starch and sucrose metabolism
    PST_0470
   00520 Amino sugar and nucleotide sugar metabolism
    PST_0470
  Nucleotide metabolism
   00230 Purine metabolism
    PST_0470
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PST_0470
Enzymes [BR:psa01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     PST_0470
    5.4.2.8  phosphomannomutase
     PST_0470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(524413..526983)
Genome map
AA seq 856 aa AA seqDB search
MALFKRTAKDSGVLNPAETRSKRSGINIKPLLGGLASSLIGLGAAAALLWLGLQNAEQEQ
RTQLASAWGQSQASALQQALRQLQGDTQAVTERLMLVEALRGDGERRRDAEQRLLDLPGV
VDAHLNVRGRAVPDTSRPGPLNFAALDLLQRAEAGHAPAPEAYKVDNRWLLYSAVALRGE
GQQAIRGTLLLVTDLERLFAGLPTLPAGAGQLRLSQQFAGAPEQVLLQRGTPGNATALTL
PSGNSNWTLSYVPGSEAAPAMLTPLHLIAAALLALAGVLIGLQLVLGSQQRKLREDVLRI
SRLLQELSTGKTIQIPALSLPVLDALARNMVRLPVRPAGSAPTQAPAAAPAVRPAKPTEY
VAPPLPETDILDIDILDEDQDIFGLDTKERETAMSSAKAPNLPASIFRAYDIRGVVGDSL
TTETAYWVGRAIGSESLAKGEPNVSVGRDGRLSGPELVQHLIQGLLDSGCDVSDIGMVPT
PVLYYAANILAGKSGVMLTGSHNPPDYNGFKIVIAGDTLANEQIQVLRKRIETNDLSSGV
GKVEQVDVLERYFEQIRSDIAMAKPMKVVVDCGNGVAGVIAPKLIEALGCTVIPLYCEVD
GNFPNHHPDPGKPENLVDLIAKVKSEKADLGLAFDGDGDRVGVVTNAGTMIYPDRLLMLF
AKDVVSRNPGADIIFDVKCTRRLTPLISGYGGRPVMWKTGHSLIKKKMKESGALLAGEMS
GHIFFKERWFGFDDGIYSAARLLEILSQDKRDAEQVFAAFPCDISTPEINITVTEESKFT
IMDALQRDAKWGEANLITLDGVRVDYPKGWGLIRASNTTPVLVLRFEADSEEELSRIQDV
FRGQLLSVAPDLKLPF
NT seq 2571 nt NT seq  +upstreamnt  +downstreamnt
atggcactcttcaagcgcaccgccaaggattcaggcgtactgaacccggccgagacccgc
agcaagcgcagcggcatcaacatcaaacccttgctcggcggcctggcgagcagcctgatc
ggcctcggcgcagcggcagcgctgctctggctgggcctgcagaatgccgagcaggagcaa
cggacgcagctggccagcgcctggggccagagccaggccagcgcgctgcagcaagcgctg
cgtcagctgcagggcgatacccaggcggtgacggagcgactgatgctggtcgaagcgctg
cgcggcgacggcgaacgtcgacgcgatgccgagcagcgcctgctggacctgcccggcgta
gtcgacgcgcatctgaatgtccgcggccgcgccgtacccgacaccagccgcccgggaccg
ctgaacttcgccgcgctcgatctgctgcagcgtgcggaagccggccacgcgcccgccccc
gaagcgtacaaggtcgacaaccgctggctgctgtacagcgccgtcgccctgcgcggcgaa
ggtcagcaggcgattcgcggcacgctgctgctggtgactgacctcgaacgcctcttcgcc
ggcctcccgacgctgcccgccggcgccgggcaactgcggttgagccagcagttcgccggc
gcaccggagcaagtgctgctgcagcgcggcaccccgggcaatgccacagccctgacactg
cccagcggcaattccaactggacgctgagctacgttccgggcagcgaagccgcgccggcc
atgctgacgcccctgcacctgatcgccgcggcgctgctggcactggccggcgtactgatc
ggcctgcaactggtgctcggcagccagcaacgcaagctgcgcgaagacgtcctgcggatc
agtcgcctgctgcaggaactctccacgggcaagaccatccaaataccggccttgagcctg
ccggtcctcgacgcactggccaggaacatggtccgactgcccgtccgccccgccggatcg
gctccgactcaggcacctgccgcggcccccgccgtacggcccgccaaacctaccgagtac
gtcgctccgcccctgccggagaccgatattctcgacatcgacattctcgacgaggaccag
gacatcttcggcctcgacaccaaggagcgagaaaccgcaatgagcagcgccaaagccccg
aacttgcccgccagtatcttccgcgcctacgacatccgtggcgttgtcggcgacagcctg
accaccgaaaccgcgtactgggtcggccgcgccatcgggtccgagagcctcgccaagggt
gaacccaacgtttccgtcggccgcgacggtcgcctgtccggcccggagctggtccagcac
ctgatccagggcctgctcgacagcggctgcgacgtcagcgacatcggcatggtgccgacg
ccggtgctctactacgcggccaacatcctcgccggcaagtccggggtgatgctcaccggt
agccacaacccgccggactacaacggcttcaagatcgtcatcgccggagacaccctggcc
aacgagcagatccaggtgctgcgcaagcggatcgagaccaacgacctgtccagcggtgtc
ggcaaggtcgaacaggtcgatgtactggagcgttacttcgagcagatccgcagcgacatc
gccatggccaagccgatgaaggtggtggtcgactgcggcaacggtgtggccggcgtcatc
gcgcccaagctgatcgaggccctgggctgcacggtgatcccgctgtactgcgaggtcgac
ggcaacttccccaatcaccaccccgatcccggcaagccggagaacctggtcgacctgatc
gccaaggtgaaatccgagaaggctgatcttggtctggccttcgacggcgacggcgatcgc
gtcggcgtggtgaccaacgccggcaccatgatctacccggaccgcctgctgatgctgttc
gccaaggacgtggtttcgcgcaatccaggcgccgacatcatctttgacgtcaaatgcacc
cgccgcctgaccccgctgatcagcggctatggcggccgcccggtgatgtggaagaccggc
cattcgctgatcaagaagaagatgaaggaatccggcgcgctgctggccggcgagatgagc
ggccacatcttcttcaaggaacgctggttcggcttcgacgacggcatctacagtgctgca
cgcctgctggagatcctcagtcaggacaagcgtgacgccgaacaggtgtttgccgccttc
ccctgcgatatctcgacgccggagatcaacatcacggtgacagaggaaagcaaattcacc
atcatggacgccctgcaacgcgacgccaaatggggcgaagccaacctgatcaccctcgac
ggtgtgcgggtcgactatcccaagggctggggcctgatccgcgcctccaacaccaccccg
gtgctggtactgcgcttcgaggccgacagcgaagaagagctcagccgcatccaggacgtc
ttccgcggccagctgctcagcgttgcacccgacctcaaactgccgttctga

DBGET integrated database retrieval system