KEGG   Pseudomonas stutzeri A1501: PST_0540Help
Entry
PST_0540          CDS       T00511                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
psa  Pseudomonas stutzeri A1501
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:psa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PST_0540 (hemB)
Enzymes [BR:psa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     PST_0540 (hemB)
Exosome [BR:psa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PST_0540 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
596743..597756
Genome map
AA seq 337 aa AA seqDB search
MSFVPASRLFPATRLRRNRRDEFSRRLVRENVLTVDDLILPVFVLDGENRREAVPSMPGV
ERLSIDLLLEEAEELVALGIPALALFPVTPLEKKSLDAAEAWNPDGIAQRATRALRARFP
ELGIITDVALDPFTTHGQDGILDDNGYVQNDVTVDALVKQALSHAEAGAQVVAPSDMMDG
RIQAIREALEVAEHHNVRIMAYSAKYASAYYGPFRDAVGSAANLGKSNKNTYQMDPANGD
EALHEVGADLAEGADMVMVKPGLPYLDIVWRVKEAFKAPTFVYQVSGEYAMHMAAIQNGW
LSEAVILESLVGFKRAGADGILTYFAKQAAQQLKRGQ
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
gtgagtttcgttcctgccagccgcctgttccccgccacccgcctgcgccgcaaccgtcgc
gacgagttttcccgccgtctggtgcgcgagaacgtgctgacggtcgatgacctgatcctc
ccggtgttcgtgctcgatggcgagaaccgtcgcgaagccgtgccgtcgatgcccggcgtc
gagcggctgtccatcgacctgctgctcgaggaggccgaggagctggtggcgctgggcatc
ccggcactggcgctgttcccggtgacgccgctggaaaagaaatccctggatgccgccgaa
gcctggaatccggacggtattgcccagcgtgccacgcgtgcgctgcgtgcgcgcttcccg
gagctgggcatcatcaccgacgtcgccctcgatccgttcaccactcacggccaggacggc
atcctcgacgacaacggctacgtacagaacgacgtcaccgtcgatgcgctggtcaagcag
gcgctctcccatgccgaggccggtgctcaggtggtcgcgccgtctgacatgatggatggc
cgcattcaggcgatccgcgaggcgctggaagtggccgagcaccacaacgtgcgcatcatg
gcctattcggccaagtacgccagtgcctactacggcccgttccgcgatgcggtgggttcg
gcagcgaatctcggcaagagcaacaagaacacctaccagatggacccggccaacggcgac
gaggcacttcacgaggtgggcgcggacctggccgaaggcgccgacatggtcatggtcaag
cccggcctgccgtacctggacatcgtctggcgggtgaaggaggccttcaaggcgccgacc
ttcgtctatcaggtcagcggcgagtacgccatgcacatggccgccatccagaacggctgg
ctgagcgaggccgtcatccttgagtctttggtcggcttcaagcgcgccggggccgatggc
atcctcacctacttcgccaagcaggcggcacaacaattaaaacggggccagtga

DBGET integrated database retrieval system