KEGG   Pseudomonas stutzeri A1501: PST_0860Help
Entry
PST_0860          CDS       T00511                                 

Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
psa  Pseudomonas stutzeri A1501
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psa00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    PST_0860
Enzymes [BR:psa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     PST_0860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(954425..956065)
Genome map
AA seq 546 aa AA seqDB search
MPSGATLRLDSHHPSSECARMTSISSDTPLNGKAPVHLALRRVAIDTYRENVAYLHRDCA
ACRAEGFQALAKVEIRVNGRRILASLNLVDDPSIVGCDELGLSEDAFAQLGAEAGVPAAI
AQAEPAASIPALHRKIAGERLNRDDFLAIMRDIAEHRYSKIELTAFVVACNQGELDREEV
FFLTDAMIRVGRRLDWREHPVVDKHCIGGIPGNRTSMLVVPIVAAHGMLCPKTSSRAITS
PAGTADTMEVLANVELPFERLCEMVREERGCLAWGGSSDLSPADDVLIAVERPLSIDSPG
QMVASILSKKIAAGSTHLLLDIPIGPTAKVRSMAEAQRLRKLFEFVATRLGLTLDVVITD
GRQPIGNGIGPVLEARDVIQVLQNDPAAPIDLRQKALRLAGRMLEFDPDVRGGDGYAIAR
DILDSGRALKKMRSIIAAQGGKPFDHNHPPLARLSFDVLADCDAVVTGIDNLQLARIARL
AGAPKVQGAGVDILRKLGEPVRAGDCLYRVYADFPADLAFARQATERASGVSLGSPEQVP
TVFVEF
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
ttgccaagcggcgctacgctgaggctagatagccatcatccctccagcgaatgcgcgcgc
atgaccagcatttccagcgacacgccgctcaacggcaaagccccggtgcacctggcgctg
cgccgggtcgccatcgacacctaccgcgagaatgtcgcctatctgcaccgcgactgcgcc
gcctgccgcgccgaaggcttccaggcgctggccaaggtggagatacgcgtcaacggccgg
cgcattctcgccagcctcaacctggtggacgacccgagcatcgtcggctgcgacgagctg
ggcctgtccgaagatgccttcgcccagctcggcgccgaagccggtgtacccgcggcgatc
gcccaggccgagccggccgcatcgatcccggcgctgcaccgcaagatcgccggcgagcgc
ctgaaccgggatgacttcctggcgatcatgcgcgacatcgccgaacaccgttactcgaag
atcgagctgaccgccttcgtggtcgcctgcaaccagggcgagctggatcgcgaggaggtg
ttctttctcaccgacgcgatgatccgcgtcggccgccggctcgactggcgcgagcacccg
gtggtggacaagcactgcatcggcggcatcccgggcaaccgcacctctatgctggtggtg
ccgatcgtcgccgcccacggcatgctatgcccgaagaccagctcgcgggccatcacctcg
ccggccggcaccgccgacaccatggaggtgctggccaacgtcgaactgccgttcgagcgc
ctctgcgaaatggtccgcgaggaacgcggctgcctggcctggggcggcagcagcgacctc
tccccggccgatgacgtgctgatcgccgtcgagcggccgctgtcgatcgactcgccgggg
cagatggtcgcctccatcctgtcgaagaagatcgccgccggttccacccatctgctgctg
gacattcccatcggcccgaccgccaaggtgcgctcgatggccgaggcgcagcgcctgcga
aagctgttcgagttcgtggccacgcgccttggcctgaccctggacgtggtcatcaccgac
ggtcgccagccgatcggcaacggcatcggcccggtactggaggcgcgcgacgtgatacag
gtgctgcagaacgacccggcggcgccgatcgacctgcgtcagaaggccctgcgcctggcc
gggcgcatgctcgagttcgatcccgatgtgcgcggcggcgacggttatgccatcgcccgt
gacatcctcgactccgggcgggcgctgaagaagatgcgctcgatcatcgccgcccagggc
ggcaagccgttcgatcacaaccatccgccgctggcacggctcagcttcgatgtactggcc
gactgcgacgcggtggtcaccggcatcgacaacctgcagctggcacgcatcgcccggctg
gccggcgcacccaaggtgcagggcgccggcgtggacatcctgcgcaagctcggcgaaccg
gtgcgggccggcgactgtctgtatcgcgtttacgcggactttcccgccgacctcgccttc
gcccgccaggccaccgaacgcgccagcggcgtcagcctcggcagccccgagcaggtccca
accgtattcgtggagttctga

DBGET integrated database retrieval system