KEGG   Pseudomonas stutzeri A1501: PST_0861Help
Entry
PST_0861          CDS       T00511                                 

Definition
3-hydroxybutyrate dehydrogenase (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
psa  Pseudomonas stutzeri A1501
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:psa00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:psa00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(956121..956891)
Genome map
AA seq 256 aa AA seqDB search
MNLTGKTALVTGSTSGIGLGIALKLAEAGADLILNGFGDASAALAEVGRHGRKVGHHGAD
VSDPAQIAELFAYAERDFGGVDILVNNAGIQHVAPVEEFPVERWDAIIAINLSSAFHTTR
LALPGMRQRGWGRIINIASVHGLVGSEQKAAYVAAKHGLVGLTKVVALETATTPITCNAI
CPGWVLTPLVQQQIDERARESGDEQRARHDLLAEKQPSLDFVTPTQLGAMALFLCSEAGD
QVRGAAWNMDGGWAAR
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgaacctcacaggcaagaccgcactggtcaccggctccaccagcggcatcgggctgggc
attgcgctgaagctggccgaggccggcgccgatctgatcctcaacggcttcggcgatgcc
tcggcagcgctggccgaagtcggcagacacggccgcaaggtcgggcaccacggggcggac
gtgtccgatccggcacagatcgccgagctgttcgcttatgccgagcgcgacttcggcggc
gtcgacatcctggtcaacaacgccggcatccagcacgtggcgccggtggaggagtttccc
gtcgagcgctgggacgccatcatcgccatcaacctgtcctcggcattccacaccacacgc
ctggcgctgcccggcatgcgccagcgcggctgggggcggatcatcaatatcgcctcggtg
cacgggctggtcggctccgagcagaaggccgcctacgtcgccgccaagcacgggctggtc
gggctgaccaaggtcgtcgcgctggaaaccgccaccacgccgatcacctgcaatgccatc
tgccccggctgggtgctgaccccgctggtacagcagcagatcgacgagcgcgcgcgggag
agcggcgacgagcagcgcgcccgccacgacctactggccgagaagcagccttcgctggac
ttcgtcacccccacgcagctgggtgcgatggcgctgttcctctgcagcgaggccggcgat
caggtacgcggcgccgcgtggaacatggacggcggctgggccgcgcgctga

DBGET integrated database retrieval system